Каталог :: Биология

Реферат: Белки: история исследования, химсостав, свойства, биологические функции

                        Глава 1. Введение.                        
Довольно банальными стали сейчас сообщения о революции в биологии. Бесспорным
считается и то, что эти революционные изменения были связаны с формированием
на стыке биологии и химии комплекса наук, среди которых центральное положение
занимали и занимают молекулярная биология и биоорганическая химия.
“Молекулярная биология - наука, ставящая своей целью познание природы явлений
жизнедеятельности путем изучения биологических объектов и систем на уровне,
приближающемся к молекулярному. характерные проявления жизни. обусловлены
структурой, свойствами и взаимодействием молекул биологически важных веществ, в
первую очередь белков и нуклеиновых кислот”
“Биоорганическая химия - наука, изучающая вещества, лежащие в основе
процессов жизнедеятельности.основные объекты биоорганической химии -
биополимеры (белки и пептиды, нуклеиновые кислоты и нуклеотиды, липиды,
полисахариды и т.д.).
Из этого сопоставления становится очевидным, сколь важно для развития
современной биологии изучение белков.
Глава 2. История исследования белка
     2.1. Начальные этапы в химии белка
Белок попал в число объектов химических исследований 250 лет тому назад. В
1728 году итальянский ученый Якопо Бартоломео Беккари получил из пшеничной
муки первый препарат белкового вещества – клейковины. Он подверг клейковину
сухой перегонке  и убедился, что продукты такой перегонки были щелочными. Это
было первое доказательство единства природы веществ растительного и животного
царств. Он опубликовал результаты своей работы в 1745 году, и это была первая
статья о белке.
В XVIII – начале XIX веков неоднократно описывали белковые вещества
растительного и животного происхождения. Особенностью таких описаний было
сближение этих веществ и сопоставление их с веществами неорганическими.
Важно отметить, что в это время, еще до появления элементного анализа,
сложилось представление о том, что белки из различных источников – это группа
близких по общим свойствам индивидуальных веществ.
     

Формулы белков

Д. Дальтона

В 1810 году Ж. Гей-Люссак и Л. Тенар впервые определили элементный состав белковых веществ. В 1833 году Ж. Гей-Люссак доказал, что в белках обязательно присутствует азот, а вскоре было показано, что содержание азота в различных белках приблизительно одинаково. В это же время английский химик Д. Дальтон попытался изобразить первые формулы белковых веществ. Он представлял их довольно просто устроенными веществами, но чтобы подчеркнуть их индивидуальное различие при одинаковом составе, он прибег к изображению молекул, которые бы сейчас назвали изомерными. Однако понятия изомерии во времена Дальтона еще не было. Были выведены первые эмпирические формулы белков и выдвинуты первые гипотезы относительно закономерностей их состава. Так, Н.Либеркюн считал, что альбумин описывается формулой C72H112N18SO22 , а А.Данилевский полагал, что молекула этого белка по крайней мере на порядок больше: C726H1171N194S3O214 . Немецкий химик Ю. Либих в 1841 году предположил, что белки животного происхождения имеют аналоги среди растительных белков: усвоение белка легумина в организме животного, по Либиху, вело к накоплению аналогичного белка – казеина. Одной из самых распространенных теорий доструктурной органической химии была теория радикалов – неизменных компонентов родственных веществ. В 1836 году голландец Г. Мульдер высказал предположение о том, что все белки содержат один и тот же радикал, который он назвал протеином (от греческого слова “первенствую”, “занимаю первое место”). Протеин, по Мульдеру, имел состав Pr = C40H62N10O12. В 1838 году Г. Мульдер опубликовал формулы белков, построенные на основании теории протеина. Это были т.н. дуалистические формулы, где радикал протеина служил положительной группировкой, а атомы серы или фосфора – отрицательной . Вместе они образовывали электронейтральную молекулу: белок сыворотки крови Pr 10S2P, фибрин Pr10SP. Однако аналитическая проверка данных Г. Мульдера, проведенная русским химиком Лясковским, а также Ю. Либихом, показала, что “белковых радикалов” не существует. В 1833 году немецкий ученый Ф. Розе открыл биуретовую реакцию на белки – одну из основных цветных реакций на белковые вещества и их производные в настоящее время (подробнее о цветных реакциях на стр.53). Был сделан также вывод о том, что это самая чувствительная реакция на белок, поэтому она в то время привлекла наибольшее внимание химиков. В середине XIX века были разработаны многочисленные методы экстракции белков, очистки и выделения их в растворах нейтральных солей. В 1847 году К. Рейхерт открыл способность белков образовывать кристаллы. В 1836 году Т. Шванн открыл пепсин – фермент, расщепляющий белки. В 1856 году Л. Корвизар открыл еще один подобный фермент – трипсин. Изучая действие этих ферментов на белки, биохимики пытались разгадать тайну пищеварения. Однако наибольшее внимание внимание привлекли вещества, получающиеся в результате действия на белки протелитических фермнтов (протеаз, к ним относятся вышеприведенные ферменты): одни из них были фрагментами исходных молекул белка (их назвали пептонами), другие же не подвергались дальнейшему расщеплению протеазами и относились к известному еще с начала века классу соединений – аминокислот (первое аминокислотное производное – амид аспарагин был открыт в 1806 году, а первая аминокислота – цистин в 1810). Аминокислоты в составе белков впервые обнаружил в 1820 году французский химик А. Браконно. Он применил кислотный гидролиз белка и в гидролизате обнаружил сладковатое вещество, названное им глицином. В 1839 году было доказано существование в составе белков лейцина, а в 1849 году Ф. Бопп выделил из белка еще одну аминокислоту – тирозин (полный список дат открытий аминокислот в белках см. Приложение II). К концу 80-х гг. XIX века из белковых гидролизатов было выделено уже 19 аминокислот и стало медленно укрепляться мнение, что сведения о продуктах гидролиза белков несут важную информацию о строении белковой молекулы. Тем не менее, аминокислоты считались обязательным, но неглавным компонентом белка. В связи с открытиями аминокислот в составе белков французский ученый П. Шютценберже в 70-х гг. XIX века предложил т. н. уреидную теорию строения белка. Согласно ей молекула белка состояла из центрального ядра, роль которого выполняла молекула тирозина, и присоединенных к нему (с замещением 4 атомов водорода) слож ных группировок, названных Шютценберже лейцинами . Однако гипотеза было очень слабо подкреплена экспериментально, и дальнейшие исследования показали несостоятельность.

2.2. Теория “углеазотных комплексов” А.Я.Данилевского

Оригинальную теорию о строении белка высказал в 80-х гг. XIX века русский биохимик А. Я. Данилевский. Первым из химиков он обратил внимание на возможный полимерный характер строения белковых молекул. В начале 70-х гг. он писал А.М. Бутлерову, что “частицы альбумина есть смешанный полимерид”, что для определения белка он не находит “термина более подходящего, чем слово полимер в широком смысле”. Изучая биуретовую реакцию он предположил, что эта реакция связана со структурой перемежающихся атомов углерода и азота – N – C – N – C – N – , которые входят в т.н. углеазотный комплекс R’ – NH – CO – NH – CO – R”. На основе данной формулы Данилевский полагал, что в молекуле белка содержится 40 таких углеазотных комплексов. Отдельные углеазотноаминокислотные комплекс, по Данилевскому, выглядели так: R – NH – CO – NH – CO – NH – CH2 – COOH Глицин R – NH – CO – NH – CO – NH – C2H4 – COOH

Аланин

R – NH – CO – NH – CO – NH – C2H3(OH) – COOH Серин По Данилевскому углеазотные комплексы могли соединяться эфирной или амидной связью с образованием высокомолекулярной структуры.

2.3. Теория “киринов” А.Косселя

Немецкий физиолог и биохимик А. Коссель, изучая протамины и гистоны, относительно просто устроенные белки, он установил, что при их гидролизе образуется большое количество аргинина. Кроме того он открыл в составе гидролизата неизвестную тогда аминокислоту – гистидин. На основании этого Коссель предположил, что эти белковые вещества можно рассматривать как некие простейшие модели более сложных белков, построенных, по его мнению, согласно следующему принципу: аргинин и гистидин составляют центральное ядро (“протаминовое ядро”), которое окружено комплексами из других аминокислот. Теория Косселя представляла собой наиболее совершенный пример развития гипотезы о фрагментарном строении белков (впервые предложенной, как было сказано выше, Г.Мульдером). Этой гипотезой воспользовался немецкий химик М. Зигфрид в начале XX века. Он полагал, что белки построены из комплексов аминокислот (аргинин+лизин+глутаминовая к-та), названных им киринами (от греческого “кириос” - основной). Однако эта гипотеза была высказана в 1903 году, когда Э. Фишер активно разрабатывал свою пептидную теорию, давшую ключ к тайне строения белков.

2.4. Пептидная теория Э.Фишера

Немецкий химик Эмиль Фишер, уже прославившийся на весь мир исследованиями пуриновых соединений (алкалоидов группы кофеина) и расшифровкой структуры сахаров, создал пептидную теорию, во многом подтвердившуюся практически и получившую всеобщее признание еще при его жизни, за что он был удостоен второй в истории химии Нобелевской премии (первую получил Я.Г. Вант-Гофф). Немаловажно, что Фишер построил план исследования, резко отличающийся от того, что предпринималось раньше, однако учитывающий все известные на тот момент факты. Прежде всего он принял, как наиболее вероятную гипотезу о том, что белки построены из аминокислот, соединенных амидной связью: R – CH – NH – CO – CH – R’ | | HOOC NH2 Такой тип связи Фишер назвал (по аналогии с пептонами) пептидной. Он предположил, что белки представляют собой полимеры аминокислот, соединенных пептидной связью. Идея о полимерном характере строения белков как известно высказывалась еще Данилевским и Хертом, но они считали, что “мономеры” представляют собой очень сложные образования – пептоны или “углеазотные комплексы”. Доказывая пептидный тип соединения аминокислотных остатков. Э. Фишер исходил из следующих наблюдений. Во-первых, и при гидролизе белков, и при их ферментативном разложении образовывались различные аминокислоты. Другие соединения было чрезвычайно трудно описать а еще труднее получить. Кроме того Фишеру было известно, что у белков не наблюдается преобладания ни кислотных, ни основных свойств, значит, рассуждал он, амино- и карбоксильные группы в составе аминокислот в белковых молекулах замыкаются и как бы маскируют друг друга (амфотерность белков, как сказали бы сейчас). Решение проблемы строения белка Фишер разделил, сведя ее к следующим положениям: 1) Качественное и количественное определение продуктов полного гидролиза белков. 2) Установление строения этих конечных продуктов. 3) Синтез полимеров аминокислот с соединениями амидного (пептидного) типа. 4) Сравнение полученных таким образом соединений с природными белками. Из этого плана видно, что Фишер применил впервые новый методологический подход – синтез модельных соединений, как способ доказательства по аналогии.

2.5. Разработка методов синтеза аминокислот

Для того чтобы перейти к синтезу производных аминокислот, соединенных пептидной связью, Фишер провел большую работу по изучению строения и синтезу аминокислот. До Фишера общим методом синтеза аминокислот был циангидринный синтез А. Штреккера: + NH3;HCN +H+;H2O RR’C=O RR’C(NH2)CN RR’C(NH2)COOH По реакции Штреккера удалось синтезировать аланин, серин и некоторые другие аминокислоты, а по ее модификации ( реакции Зелинского-Стадникова) как a- аминокислоты, так и их N-замещенные. Однако сам Фишер стремился разработать методы синтеза всех известных тогда аминокислот. Он считал метод Штреккера недостаточно универсальным. Поэтому Э. Фишеру пришлось искать общий метод синтеза аминокислот в том числе аминокислот со сложными боковыми радикалами. Он предложил аминировать бромзамещенные в a-положении карбоновые кислоты. Для получения бромпроизводных он использовал, как например, в синтезе лейцина, арилированную или алкилированную малоновую кислоту: Br2 – CO2 (CH3)2CHCH2CH(COOH)2 (CH3)2CHCH2CHBr(COOH)2 NH3 (CH3)CHCH2CHBrCOOH (CH3)2CHCH2CHNH2COOH Но создать абсолютно универсальный метод Э. Фишеру не удалось. Были разработаны и более надежные реакции. Например, ученик Фишера Г. Лейкс предложил следующую модификацию для получения серина:
HCN
C2H5OCH2CHO C2H5OCH2CH(NH2)CN HBr C2H5OCH2CH(NH2)COOH HOCH2CHNH2COOH Фишер также доказал, что белки состоят из остатков оптически активных аминокислот (см. стр.11). Это заставило его разработать новую номенклатуру оптически активных соединений, методы разделения и синтеза оптических изомеров аминокислот. Фишер также пришел к выводу, что в белках содержатся остатки L-форм оптически активных аминокислот, и он доказал это, впервые использовав принцип диастереоизомерии. Этот принцип заключался в следующем: к N-ацилпроизводному рацемической аминокислоты добавляли оптически активный алкалоид (бруцин, стрихнин, цинхонин, хинидин, хинин). В результате этого образовывались две стереоизомерные формы солей, обладающие различной растворимостью. После разделения этих диастереоизомеров алкалоид регенерировали и ацильную группу удаляли путем гидролиза. Фишер сумел разработать метод полного определения аминокислот в продуктах гидролиза белков: он переводил хлоргидраты эфиров аминокислот обработкой концентрированной щелочью на холоду в свободные эфиры, которые заметно не омылялись. Затем смесь этих эфиров подвергал фракционной перегонке и из полученных фракций выделял отдельные аминокислоты путем дробной кристаллизации. Новый метод анализа не только окончательно подтвердил, что белки состоят из аминокислотных остатков, но позволил уточнить и пополнить список встречающихся в белках аминокислот. Но все же количественные анализы не могли дать ответа на основной вопрос: каковы принципы строения молекулы белка. И Э.Фишер сформулировал одну из основных задач в изучении строения и свойств белка: разработка экспериментальные методы синтеза соединений, основными компонентами которых были бы аминокислоты, соединенные пептидной связью. Таким образом Фишер поставил нетривиальную задачу – синтезировать новый класс соединений с целью установления принципов их строения. Задачу эту Фишер решил, и химики получили убедительные доказательства, что белки представляют собой полимеры аминокислот, соединенных пептидной связью: ««« – CO – CHR’ – NH – CO – CHR’’ – NH – CO CHR’’’ – NH – ««« Это положение подтверждалось биохимическими доказательствами. Попутно выяснилось, что протеазы гидролизуют не все связи между аминокислотами с одинаковой скоростью. На их способность расщеплять пептидную связь влияли оптическая конфигурация аминокислот, заместители по азоту аминогруппы, длина цепи пептида, а также набор входящих в него остатков. Главным доказательством пептидной теории стал синтез модельных пептидов и сопоставление их с пептонами гидролизата белков. Результаты показали, что из белковых гидролизатов выделяются пептиды, идентичные синтезированным. В процессе выполнения этих исследований Э.Фишер и его ученик Э.Абдергальд- ен впервые разработали метод определения аминокислотной последовательности в белка. Сущность его заключалась в установлении природы аминокислотного остатка полипептида, имеющего свободную аминогруппу (N-концевую аминокислоту). Для этого они предложили блокировать в пептиде аминоконец b- нафталин-сулфониловой группой, которая не отщепляется при гидролизе. Выделяя затем из гидролизата аминокислоту, меченую такой группой, можно было определить, какая из аминокислот была N-концевой. После исследований Э.Фишера стало ясно, что белки представляют собой полипептиды. Это было важное достижение, в том числе и для задач синтеза белков: стало ясно, что именно нужно синтезировать. Только после этих работ проблема синтеза белка приобрела определенную направленность и необходимую строгость. Говоря о работе Фишера в целом, следует отметить, что сам подход к исследованию был типичен скорее для наступающего XX века – он оперировал широким набором теоретических положений и методических приемов; его синтезы все менее и менее походили на искусство, основанное на интуиции, чем на точном знании, и приближались к созданию серий точных, почти технологических приемов.

2,6, Кризис пептидной теории

В связи с применением новых физических и физико-химических методов исследований в начале 20-х гг. XX в. появились сомнения в том, что молекула белка представляет длинную полипептидную цепь. К гипотезе о возможности компактной укладки пептидных цепочек относились со скептицизмом. Все это потребовало пересмотра пептидной теории Э.Фишера. В 20-30-е гг. распространение получила дикетопиперазиновая теория. Согласно ей, центральная роль в построении структуры белка играют дикетопиперазивные кольца, образующиеся при циклизации двух аминокислотных остатков. Также предполагалось, что эти структуры составляют центральное ядро молекулы, к которому присоединены короткие пептиды или аминокислоты (“наполнители” циклического скелета основной структуры). Наиболее убедительные схемы участия дикетопиперазинов в построении структуры белка были представлены Н.Д.Зелинским и учениками Э.Фишера. Однако попытки синтеза модельных соединений, содержащих дикетопиперазины мало, что дали для химии белка - впоследствии восторжествовала пептидная теория, однако эти работы оказали стимулирующее влияние на химию пиперазинов в целом. После пептидной и дикетопиперазивной теорий продолжались попытки доказать существование только пептидных структур в молекуле белка. При этом стремились представить себе не только тип молекулы, но и общие ее очертания. Оригинальную гипотезу высказал советский химик Д.Л.Талмуд. Он предположил, что пептидные цепи в составе белковых молекул свернуты в большие кольца, что в свою очередь стало шагом к созданию им представления о белковой глобуле. Одновременно появились данные, свидетельствующие о различном наборе аминокислот в различных белка. Но закономерности, которым подчиняется последовательность аминокислот в структуре белка, были не ясны. Первыми ответ на этот вопрос пытались дать М.Бергман и К.Ниман в разработанной ими гипотезе “перемежающихся частот”. Согласно ей последовательность аминокислотных остатков в белковой молекуле подчинялась числовым закономерностям, основы которых были выведены из принципов строения белковой молекулы фиброина шелка. Но этот выбор был неудачным, т.к. этот белок фибриллярный, строение же глобулярных белков подчиняется совсем другим закономерностям. По М.Бергману и К.Ниману, каждая аминокислота встречается в полипептидной цепи через определенной интервал или, как говорил М.Бергман, обладает определенной “периодичностью”.эта периодичность определяется природой аминокислотных остатков. Молекулу фиброина шелка они представляли себе следующим образом:

Gly·Ala·Gly·Tyr· Gly·Ala·Gly·Arg· Gly·Ala·Gly·x· Gly·Ala·Gly·x·

(Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·x)12 Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·Arg· (Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·x)13 Гипотеза Бергмана-Нимана оказала значительное влияние на развитие химии аминокислот - большое количество работ было посвящено ее проверке. В заключение этой главы следует отметить, что к середине XX в. было накоплено достаточно доказательств справедливости пептидной теории, основные ее положения были дополнены и уточнены. Поэтому центр исследований белков в XX в. лежал уже области исследования и поиска методов синтеза белка искусственным путем. Эта задача была успешно решена, были разработаны надежные методы определения первичной структуры белка - последовательности аминокислот в пептидной цепи, разработаны методы химического (абиогенного) синтеза нерегулярных полипептидов (подробнее эти методы рассматриваются в гл.8, стр.36), в том числе методы автоматического синтеза полипептидов. Это позволило уже в 1962 г. крупнейшему английскому химику Ф.Сенгеру расшифровать структуру и синтезировать искусственным путем гормон инсулин, что ознаменовало новую эру в синтезе полипептидов - функциональных белков. Глава 3. Химический состав белков.

3.1. Пептидная связь

Белки представляют собой нерегулярные полимеры, построенные из остатков a-аминокислот, общую формулу которых в водном растворе при значениях pH близких к нейтральным можно записать как NH3+CHRCOO . Остатки аминокислот в белках соединены между собой амидной связью между a-амино- и a-карбоксильными группами. Пептидная связь между двумя a-аминокислотными остатками обычно называется пептидной связью, а полимеры, построенные из остатков a-аминокислот, соединенных пептидными связями, называют полипептидами. Белок как биологически значимая структура может представлять собой как один полипептид, так и несколько полипептидов, образующих в результате нековалентных взаимодействий единый комплекс.

3.2. Элементный состав белков

Изучая химический состав белков, необходимо выяснить, во-первых, из каких химических элементов они состоят, во-вторых, - строение их мономеров. Для ответа на первый вопрос определяют количественный и качественный состав химических элементов белка. Химический анализ показал наличие во всех белках углерода (50-55%), кислорода (21-23%), азота (15-17%), водорода (6-7%), серы (0,3-2,5%). В составе отдельных белков обнаружены также фосфор, йод, железо, медь и некоторые другие макро- и микроэлементы, в различных, часто очень малых количествах. Содержание основных химических элементов в белках может различаться, за исключением азота, концентрация которого характеризуется наибольшим постоянством и в среднем составляет 16%. Кроме того, содержание азота в других органических веществах мало. В соответствии с этим было предложено определять количество белка по входящему в его состав азоту. Зная, что 1г азота содержится в 6,25 г белка, найденное количество азота умножают коэффициент 6,25 и получают количество белка. Для определения химической природы мономеров белка необходимо решить две задачи: разделить белок на мономеры и выяснить их химический состав. Расщепление белка на его составные части достигается с помощью гидролиза – длительного кипячения белка с сильными минеральными кислотами (кислотный гидролиз) или основаниями (щелочной гидролиз). Наиболее часто применяется кипячение при 110 ° С с HCl в течение 24 ч. На следующем этапе разделяют вещества, входящие в состав гидролизата. Для этой цели применяют различные методы, чаще всего – хроматографию ( подробнее – глава “Методы исследования.”). Главным частью разделенных гидролизатов оказываются аминокислоты.

3.3. Аминокислоты

В настоящее время в различных объектах живой природы обнаружено до 200 различных аминокислот. В организме человека их, например, около 60. Однако в состав белков входят только 20 аминокислот, называемых иногда природными. Аминокислоты – это органические кислоты, у которых атом водорода a-углеродного атома замещен на аминогруппу – NH2. Следовательно, по химической природе это a-аминокислоты с общей формулой: R | H – C a – NH2 | COOH Из этой формулы видно, что в состав всех аминокислот входят следующие общие группировки: – CH2, – NH2, – COOH. Боковые же цепи (радикалы – R ) аминокислот различаются. Как видно из Приложения I химическая природа радикалов разнообразна: от атома водорода до циклических соединений. Именно радикалы определяют структурные и функциональные особенности аминокислот. Все аминокислоты, кроме простейшей аминоуксусной к-ты глицина (NH3 +CH2COO-) имеют хиральный атом Ca и могут существовать в виде двух энантиомеров (оптических изомеров): H H

Ca Ca

COO – COO – NH3+ R R NH3+ L-изомер D-изомер В состав всех изученных в настоящее время белков входят только аминокислоты L-ряда, у которых, если рассматривать хиральный атом со стороны атома H, группы NH3+, COO- и радикал R расположены по часовой стрелке. Необходимость при построении биологически значимой полимерной молекулы строить ее из строго определенного энантиомера очевидна – из рацемической смеси двух энантиомеров получилась бы невообразимо сложная смесь диастереоизомеров. Вопрос, почему жизнь на Земле основана на белках, построеных именно из L-, а не D-a-аминокислот, до сих пор остается интригующей загадкой. Следует отметить, что D-аминокислоты достаточно широко распространены в живой природе и, более того, входят в состав биологически значимых олигопептидов. Из двадцати основных a-аминокислот строятся белки, однако остальные, достаточно разнообразные аминокислоты образуются из этих 20 аминокислотных остатков уже в составе белковой молекулы. Среди таких превращений следует в первую очередь отметить образование дисульфидных мостиков при окислении двух остатков цистеина в составе уже сформированных пептидных цепей. В результате образуется из двух остатков цистеина остаток диаминодикарбоновой кислоты цистина (см. Приложение I). При этом возникает сшивка либо внутри одной полипептидной цепи, либо между двумя различными цепями. В качестве небольшого белка, имеющего две полипептидные цепи, соединенный дисульфидными мостиками, а также сшивки внутри одной из полипептидных цепей: | |

GIVEQCCASVCSLYQLENYCN

| | FVNQHLCGSHLVEALYLVCGERGFFYTPKA Важным примером модификации аминокислотных остатков является превращение остатков пролина в остатки гидроксипролина:

N – CH – CO – N – CH – CO –

CH2 CH2 CH2 CH2

CH2 CHOH Это превращение происходит, причем в значительном масштабе, при образовании важного белкового компонента соединительной ткани – коллагена. Еще одним весьма важным видом модификации белков является фосфорилирование гидроксогрупп остатков серина, треонина и тирозина, например: – NH – CH – CO – – NH – CH – CO – | | CH2OH CH2OPO32 – Аминокислоты в водном растворе находятся в ионизированном состоянии за счет диссоциации амино- и карбоксильных групп, входящих в состав радикалов. Другими словами, они являются амфотерными соединениями и могут существовать либо как кислоты (доноры протонов), либо как основания (акцепторы доноров). Все аминокислоты в зависимости от структуры разделены на несколько групп: Ациклические. Моноаминомонокарбоновые аминокислоты имеют в своем составе одну аминную и одну карбоксильную группы, в водном растворе они нейтральны. Некоторые из них имеют общие структурные особенности, что позволяет рассматривать их вместе: 1. Глицин и аланин. Глицин (гликокол или аминоуксусная к-та) является оптически неактивным – это единственная аминокислота, не имеющая энатиомеров. Глицин участвует в образовании нуклеиновых и желчных к-т, гема, необходим для обезвреживания в печени токсичных продуктов. Аланин используется организмом в различных процессах обмена углеводов и энергии. Его изомер b-аланин является составной частью витамина пантотеновой к-ты, коэнзима А (КоА), экстрактивных веществ мышц. 2. Серин и треонин. Они относятся к группе гидрооксикислот, т.к. имеют гидроксильную группу. Серин входит в состав различных ферментов, основного белка молока – казеина, а также в состав многих липопротеинов. Треонин участвует в биосинтезе белка, являясь незаменимой аминокислотой. 3. Цистеин и метионин. Аминокислоты, имеющие в составе атом серы. Значение цистеина определяется наличием в ее составе сульфгидрильной ( – SH) группы, которая придает ему способность легко окисляться и защищать организм о веществ с высокой окислительной способностью (при лучевом поражении, отравлении фосфором). Метионин характеризуется наличием легко подвижной метильной группы, использующейся для синтеза важных соединений в организме (холина, креатина, тимина, адреналина и др.) 4. Валин, лейцин и изолейцин. Представляют собой разветвленные аминокислоты, которые активно участвуют в обмене веществ и не синтезируются в организме. Моноаминодикарбоновые аминокислоты имеют одну аминную и две карбоксильные группы и в водном растворе дают кислую реакцию. К ним относятся аспарагиновая и глутаминовая к-ты, аспарагин и глутамин. Они входят в состав тормозных медиаторов нервной системы. Диаминомонокарбоновые аминокислоты в водном растворе имеют щелочную реакцию за сет наличия двух аминных групп. Относящийся к ним лизин необходим для синтеза гистонов а также в ряд ферментов. Аргинин участвует в синтезе мочевины, креатина. Циклические. Эти аминокислоты имеют в своем составе ароматическое или гетероциклическое ядро и, как правило, не синтезируется в организме человека и должны поступать с пищей. Они активно участвуют в разнообразных обменных процессах. Так фенил-аланин служит основным источником синтеза тирозина – предшественника ряда биологически важных веществ: гормонов (тироксина, адреналина), некоторых пигментов. Триптофан помимо участия в синтезе белка, служит компонентом витамина PP, серотонина, триптамина, ряда пигментов. Гистидин необходим для синтеза белков, является предшественником гистамина, влияющего на кровяное давление и секрецию желудочного сока. Глава 4. Структура. При изучении состава белков было установлено, что все они построены по единому принципу и имеют четыре уровня организации: первичную, вторичную, третичную, а отдельные из них и четвертичную структуры.

4.1. Первичная структура

Представляет собой линейную цепь аминокислот, расположенных в определенной последовательности и соединенных между собой пептидными связями. Пептидная связь образуется за счет a-карбоксильной группы одной аминокислоты и a-аминной группы другой:

Ci a

O - H2O O H2N – CH – C + NH – CH – COOH H2 N – CH – C ¾ NH – CH – COOH | OH H | | | R R1 R R

Пептидная связь вследствие p, p-сопряжения p-связи карбонильной группы и р-орбитали атома N, на котором находится не поделенная пара электронов, не может рассматриваться как одинарная и вращение вокруг нее практически отсутствует. По этой же причине хиральный атом C a и карбонильный атом C k любого i-го аминокислотного остатка пептидной цепи и атомы N и Сa(i+1)-го остатка находятся в одной плоскости. В этой же плоскости находятся карбонильный атом О и амидный атом Н ( однако накопленный при изучении структуры белков материал показывает, что это утверждение не совсем строго: атомы, связанные с пептидным атомом азота, находятся не в одной плоскости с ним, а образуют трехгранную пирамиду с углами между связями, очень близкими к 120°. Поэтому между плоскостями, образованными атомами Ci a, Cik, Oi и Ni+1, Hi+1 , Ci+1a , существует некоторый угол, отличающийся от 0°. Но, как правило, он не превышает 1° и не играет особой роли). Поэтому геометрически полипептидную цепочку можно рассматривать как образованную такими плоскими фрагментами, содержащими каждый по шесть атомов. Взаимное расположение этих фрагментов, как и всякое взаимное расположение двух плоскостей, должно определятся двумя углами. В качестве таковых принято брать торсионные углы, характеризующие вращения вокруг s-связей N ¾ C a и C a ¾ C k. Геометрия любой молекулы определяется тремя группами геометрических характеристик ее химических связей – длинами связей, валентными углами и торсионными углами между связями, примыкающими к соседним атомам. Первые две группы в решающей мере определяются природой участвующих атомов и образующихся связей. Поэтому пространственная структура полимеров в основном определяется торсионными углами между звеньями полимерного остова молекул, т.е. конформацией полимерной цепи. Торсионный угол, т.е. угол поворота связи А-В вокруг связи В-С относительно связи С-D, определяется как угол между плоскостями, содержащими атомы А, В, С и атомы B, C, D. В такой системе возможен случай, когда связи А-В и С-D расположены параллельно и находятся по одну сторону от связи В-С. Если рассматривать эту систему вдоль связи В-С, то связь А-В как бы заслоняет связь C-D, поэтому такая конформация называется заслоненной. Согласно рекомендациям международных союзов химии IUPAC (International Union of Pure and Applied Chemistry) и IUB (International Union of Biochemistry), угол между плоскостями ABC и BCD считается положительным, если для приведения конформации в заслоненное состояние путем поворота на угол не выше 180° ближнюю к наблюдателю связь нужно поворачивать по часовой стрелке. Если эту связь для получения заслоненной конформации нужно поворачивать против часовой стрелки, то угол считается отрицательным. Можно заметить, что это определение не зависит от того, какая из связей находится ближе к наблюдателю. При этом, как видно из рисунка, ориентация фрагмента, содержащего атомы C i-1a и Cia [(i-1)-й фрагмент], и фрагмента, содержащего атомы Cia и Ci+1a (i-й фрагмент), определяется торсионными углами, соответствующими вращению вокруг связи Ni¾Cia и связи Ci a¾Cik. Эти углы принято обозначать как j и y, в приведенном случае соответственно ji и yi. Их значениями для всех мономерных звеньев полипептидной цепи в основном определяется геометрия этой цепи. Никаких однозначных величин ни для значения каждого из этих углов, ни для их комбинаций не существует, хотя на те и на другие накладываются ограничения, определяемые как свойствами самих пептидных фрагментов, так и природой боковых радикалов, т.е. природой аминокислотных остатков. К настоящему времени установлены последовательности аминокислот для нескольких тысяч различных белков. Запись структуры белков в виде развернутых структурных формул громоздка и не наглядна. Поэтому используется сокращенная форма записи – трехбуквенная или однобуквенная (молекула вазопрессина): Cys – Tyr – Phe – Gln – Asn – Cys – Pro – Arg – Gly – NH2 CYFQNCPRG – NH2
S S При записи аминокислотной последовательности в полипептидных или олигопептидных цепях с помощью сокращенной символики предполагается, если это особо не оговорено, что a-аминогруппа находится слева, а a-карбоксильная группа – справа. Соответствующие участки полипептидной цепи называют N-концом (аминным концом) и С-концом (карбоксильным концом), а аминокислотные остатки – соответственно N-концевым и С-концевым остатками. 4.2. Вторичная структура. Фрагменты пространственной структуры биополимер, имеющие периодическое строение полимерного остова, рассматривают как элементы вторичной структуры. Если на протяжении некоторого участка цепи однотипные углы, о которых говорилось на стр.15, приблизительно одинаковы, то структура полипептидной цепи приобретает периодический характер. Существует два класса таких структур – спиральные и растянутые (плоские или складчатые). Спиральной считается структура, у которой все однотипные атомы лежат на одной винтовой линии. При этом спираль считается правой, если при наблюдении вдоль оси спирали она удаляется от наблюдателя по часовой стрелке, и левой – если удаляется против часовой стрелки. Полипептидная цепь имеет спиральную конформацию, если все атомы Ca находятся на одной винтовой линии, все карбонильные атомы Ck - на другой, все атомы N – на третьей, причем шаг спирали для всех трех групп атомов должен быть одинаков. Одинаковым должно быть и число атомов, приходящихся на один виток спирали, независимо от того, идет ли речь об атомах Ck, Ca или N. Расстояние же до общей винтовой линии для каждого из этих трех типов атомов свое. Главными элементами вторичной структуры белков являются a-спирали и b-складки. Спиральные структуры белка. Для полипептидных цепей известно несколько различных типов спиралей. Среди них наиболее распространена правая a-спираль. Идеальная a-спираль имеет шаг 0,54 нм и число однотипных атомов на один виток спирали 3,6, что означает полную периодичность на пяти витках спирали через каждые 18 аминокислотных остатков. Значения торсионных углов для идеальной a-спирали j = – 57° y = – 47 ° , а расстояния от атомов, образующих полипептидную цепь, до оси спирали составляет для N 0,15 нм, для C a 0,23 нм, для C k 0,17 нм. Любая конформация существует при условии, что имеются факторы, стабилизирующие ее. В случае a-спирали такими факторами являются водородные связи, образуемые каждым карбонильным атомом (i+4)-го фрагмента. Важным фактором стабилизации a-спирали также является параллельная ориентация дипольных моментов пептидных связей. Складчатые структуры белка. Одним из распространенных примеров складчатой периодической структуры белка являются т.н. b-складки, состоящие из двух фрагментов, каждый из которых представлен полипептидом. b-складки также стабилизируются водородными связями между атомом водорода аминной группы одного фрагмента и атомом кислорода карбоксильной группы другого фрагмента. При этом фрагменты могут иметь как параллельную, так и антипараллельную ориентацию относительно друг друга. Структура, образующаяся в результате таких взаимодействий, представляет собой гофрированную структуру. Это сказывается на значениях торсионных углов j и y. Если в плоской, полностью растянутой структуре они должны были бы составить 180°, то в реальных b-слоях они имеют значения j = – 119° и y = + 113°. Для того чтобы два участка полипептидной цепи располагались в ориентации, благоприятствующей образованию b-складок, между ними должен существовать участок, имеющий структуру, резко отличающийся от периодической. 4.2.1. Факторы, влияющие на образование вторичной структуры. Структура определенного участка полипептидной цепи существенно зависит от структуры молекулы в целом. Факторы, влияющие на формирование участков с определенной вторичной структурой, весьма многообразны и далеко не во всех случаях полностью выявлены. Известно, что ряд аминокислотных остатков предпочтительно встречается в a-спиральных фрагментах, ряд других – в b- складках, некоторые аминокислоты – преимущественно в участках, лишенных периодической структуры. Вторичная структура в значительной степени определяется первичной структурой. В некоторых случаях физический смысл такой зависимости может быть понят из стереохимического анализа пространственной структуры. Например, как видно из рисунка в a-спирали сближены не только боковые радикалы соседних вдоль цепи аминокислотных остатков, но и некоторые пары остатков, находящихся на соседних витках спирали, в первую очередь каждый (i+1)-й остаток с (i+4)-м и с (i+5)-м. Поэтому в положениях (i+1) и (i+2), (i+1) и (i+4), (i+1) и (i+5) a-спиралей редко одновременно встречается два объемных радикала, таких, например, как боковые радикалы тирозина, триптофана, изолейцина. Еще менее совместимо со структурой спирали одновременное наличие трех объемных остатков в положениях (i+1), (i+2) и (i+5) или (i+1), (i+4) и (i+5). Поэтому такие комбинации аминокислот в a- спиральных фрагментах являются редким исключением. 4.3. Третичная структура Под этим термином понимают полную укладку в простанстве всей полипептидной цепи, включая укладку боковых радикалов. Полное представление о третичной структуре дают координаты всех атомов белка. Благодаря огромным успехом рентгеноструктурного анализа такие данные, за исключением координат атомов водорода получены для значительного числа белков. Это огромные массивы информации, хранящиеся в специальных банках данных на машиночитаемых носителях, и их обработка немыслима без применения быстродействующих компьютеров. Полученные на компьютерах координаты атомов дают полную информацию о геометрии полипептидной цепи, в том числе значения торсионных углов, что позволяет выявить спиральную структуру, b-складки или нерегулярные фрагменты. Примером такого исследовательского подхода может служить следующая пространственная модель структуры фермента фосфоглицераткиназы:

Общая схема строения фосфоглицераткиназы. Для наглядности a-спиральные участки представлены в виде цилиндров, а b-складки – в виде лент со стрелкой, указывающей направление цепи от N-конца к С-концу. Линии – нерегулярные участки, соединяющие структурированные фрагменты. Изображение полной структуры даже небольшой белковой молекулы на плоскости, будь то страница книги или экран дисплея мало информативно из-за чрезвычайно сложного строения объекта. Чтобы исследователь мог наглядно представлять простанственное строение молекул сложных веществ, используют методы трехмерной компьютерной графики, позволяющей выводить на дисплей отдельные части молекул и манипулировать с ними, в частности поворачивать их в нужных ракурсах. Третичная структура формируется в результате нековалентных взаимодействий (электростатические, ионные, силы Ван-дер-Ваальса и др.) боковых радикалов, обрамляющих a-спирали и b-складки, и непериодических фрагментов полипептидной цепи. Среди связей, удерживающих третичную структуру следует отметить: а) дисульфидный мостик ( – S – S – ) б) сложноэфирный мостик (между карбоксильной группой и гидроксильной группой) в) солевой мостик (между карбоксильной группой и аминогруппой) г) водородные связи. В соответствии с формой белковой молекулы, обусловленной третичной структурой, выделяют следующие группы белков: 1) Глобулярные белки. Пространственная структура этих белков в грубом приближении может быть представлена в виде шара или не слишком вытянутого эллипсоида - глобулы. Как правило, значительная часть полипептидной цепи таких белков формирует a-спирали и b-складки. Соотношение между ними может быть самым различным. Например, у миоглобина (подробнее о нем на стр.28) имеется 5 a-спиральных сегментов и нет ни одной b-складки. У иммуноглобулинов (подробнее на стр.42), наоборот, основными элементами вторичной структуры являются b-складки, а a-спирали вообще отсутствуют. В вышеприведенной структуре фосфоглицераткиназы и те и другие типы структур представлены примерно одинаково. В некоторых случаях, как это видно на примере фосфоглицераткиназы, отчетливо просматриваются две или более четко разделеннные в пространстве (но тем не менее, конечно, связанные пептидными мостиками) части – домены. Зачастую различные функциональные зоны белка разнесены по разным доменам. 2) Фибриллярные белки. Эти белки имеют вытянутую нитевидную форму, они выполняют в организме структурную функцию. В первичной структуре они имеют повторяющиеся участки и формируют достаточно однотипную для всей полипептидной цепи вторичнкю структуру. Так, белок a-креатин (основной белковый компонент ногтей, волос, кожи) построен из протяженных a-спиралей. Фиброин шелка состоит из периодически повторяющихся фрагментов Gly – Ala – Gly – Ser , образующими b-складки. Существуют менее распростаненные элементы вторичной структуры, пример – полипептидные цепи коллагена, образующие левые спирали с параметрами, резко отличающимися от параметров a-спиралей. В коллагеновых волокнах три спиральные полипептидные цепи скручены в единую правую суперспираль:

Четвертичная структура В большинстве случаев для функционирования белков необходимо, чтобы несколько полимерных цепей были объединены в единый комплекс. Такой комплекс также рассматривается как белок, состоящий из нескольких субъединиц. Субъединичная структура часто фигурирует в научной литературе как четвертичная структура. Белки, состоящие из нескольких субъединиц, широко распространены в природе. Классический пример – четвертичная структура гемоглобина (подробнее – стр.26). субъединицы принято обозначать греческими буквами. У гемоглобина имеется по две a и b субъединицы. Наличие нескольких субъединиц важно в функциональном отношении – это увеличивает степень насыщения кислородом. Четвертичную структуру гемоглобина обозначают как a2b2. Субъединичное строение свойственно многим ферментам, в первую очередь тем, которые выполняют сложные функции. Например, РНК-полимераза из E.coli имеет субъединичную структуру a2bb’s, т.е. построен из четырех разнотипных субъединиц, причем b-субъединица продублирована. Этот белок выполняет сложные и разнообразные функции – инициирует ДНК, связывает субстраты – рибонуклеозидтрифосфаты, а также переносит нуклеотидные остатки на растущую полирибонуклеотидную цепь и некоторые другие функции. Работа многих белков подвержена т.н. аллостерической регуляции – специальные соединения (эффекторы) “выключают” или “включают” работу активного центра фермента. Такие ферменты имеют специальные участки опознавания эффектора. И даже существуют специальные регуляторные субъединицы, в состав которых в том числе входят указанные участки. Классический пример – ферменты протеинкиназы, катализирующие перенос остатка фосфорной к-ты от молекулы АТФ на белки-субстраты. Глава 5. Свойства Белки имеют высокую молекулярную массу, некоторые растворимы в воде, способны к набуханию, характеризуются оптической активностью, подвижностью в электрическом поле и некоторыми другими свойствами. Белки активно вступают в химические реакции. Это свойство связано с тем, что аминокислоты, входящие в состав белков, содержат разные функциональные группы, способные реагировать с другими веществами. Важно, что такие взаимодействия происходят и внутри белковой молекулы, в результате чего образуется пептидная, водородная дисульфидная и другие виды связей. К радикалам аминокислот, а следовательно и белков, могут присоединяться различные соединения и ионы, что обеспечивает их транспорт по крови. Белки являются высокомолекулярными соединениями. Это полимеры, состоящие из сотен и тысяч аминокислотных остатков – мономеров. Соответственно и молекулярная масса белков находится в пределах 10 000 – 1 000 000. Так, в составе рибонуклеазы (фермента, расщепляющего РНК) содержится 124 аминокислотных остатка и ее молекулярная масса составляет примерно 14 000. Миоглобин (белок мышц), состоящий из 153 аминокислотных остатков, имеет молекулярную массу 17 000, а гемоглобин – 64 500 (574 аминокислотных остатка). Молекулярные массы других белков более высокие: g-глобулин ( образует антитела) состоит из 1250 аминокислот и имеет молекулярную массу около 150 000, а молекулярная масса фермента глутаматдегидрогеназы превышает 1 000 000. Определение молекулярной массы проводится различными методами: осмометрическим, гельфильтрационным, оптическим и др. однако наиболее точным является метод седиментации, предложенный Т. Сведбергом. Он основан на том, что при ультрацентрифугировании ускорением до 900 000 g скорость осаждения белков зависит от их молекулярной массы. Важнейшим свойством белков является их способность проявлять как кислые так и основные, то есть выступать в роли амфотерных электролитов. Это обеспечивается за счет различных диссоциирующих группировок, входящих в состав радикалов аминокислот. Например, кислотные свойства белку придают карбоксильные группы аспарагиновой глутаминовой аминокислот, а щелочные – радикалы аргинина, лизина и гистидина. Чем больше дикарбоновых аминокислот содержится в белке, тем сильнее проявляются его кислотные свойства и наоборот. Эти же группировки имеют и электрические заряды, формирующие общий заряд белковой молекулы. В белках, где преобладают аспарагиновая и глутаминовая аминокислоты, заряд белка будет отрицательным, избыток основных аминокислот придает положительный заряд белковой молекуле. Вследствие этого в электрическом поле белки будут передвигаться к катоду или аноду в зависимости от величины их общего заряда. Так, в щелочной среде (рН 7 – 14) белок отдает протон и заряжается отрицательно, тогда как в кислой среде (рН 1 – 7) подавляется диссоциация кислотных групп и белок становится катионом. NH3+ Кислая среда NH3+ Щелочная среда NH2 R R R COOH COO COO Катион Амфион Анион

COOH,NH3

COO,NH3

COO,NH3

+H+ +H+ Белок Белок Белок – H+ – H+

Таким образом, фактором, определяющим поведение белка как катиона или аниона, является реакция среды, которая определяется концентрацией водородных ионов и выражается величиной рН. Однако при определенных значениях рН число положительных и отрицательных зарядов уравнивается и молекула становится электронейтральной, т.е. она не будет перемещаться в электрическом поле. Такое значение рН среды определяется как изоэлектрическая точка белков. При этом белок находится в наименее устойчивом состоянии и при незначительных изменениях рН в кислую или щелочную сторону легко выпадает в осадок. Для большинства природных белков изоэлектрическая точка находится в слабокислой среде (рН 4,8 – 5,4), что свидетельствует о преобладании в их составе дикарбоновых аминокислот. Свойство амфотерности лежит в основе буферных свойств белков и их участии в регуляции рН крови. Величина рН крови человека отличается постоянством и находится в пределах 7,36 – 7,4 , несмотря на различные вещества кислого или основного характера, регулярно поступающие с пищей или образующиеся в обменных процессах – следовательно существуют специальные механизмы регуляции кислотно-щелочного равновесия внутренней среды организма. К таким системам относится рассматриваемая в гл. “ Классификация” гемоглобиновая буферная система (стр.28). Изменение рН крови более чем на 0,07 свидетельствует о развитии патологического процесса. Сдвиг рН в кислую сторону называется ацидозом, а в щелочную – алкалозом. Важное значение для организма имеет способность белков адсорбироватьь на своей поверхности некоторые вещества и ионы (гормоны, витамины, железо, медь), которые либо плохо растворимы в воде, либо являются токсичными ( билирубин, свободные жирные кислоты). Белки транспортируют их по крови к местам дальнейших превращений или обезвреживания. Водные растворы белков имеют свои особенности. Во-первых, белки обладают большим сродством к воде, т.е. они гидрофильны. Это значит, что молекулы белка, как заряженные частицы, притягивают к себе диполи воды, которые располагаются вокруг белковой молекулы и образуют водную или гидратную оболочку. Эта оболочка предохраняет молекулы белка от склеивания и выпадения в осадок. Величина гидратной оболочки зависит от структуры белка. Например, альбумины более легко связываются с молекулами воды и имеют относительно большую водную оболочку, тогда как глобулины, фибриноген присоединяют воду хуже, и гидратная оболочка и них меньше. Таким образом, устойчивость водного раствора белка определяется двумя факторами: наличием заряда белковой молекулы и находящейся вокруг нее водной оболочки. При удалении этих факторов белок выпадает в осадок. Данный процесс может быть обратимым и необратимым. Обратимое осаждение белков (высаливание) предполагает выпадение белка в осадок под действием определенных веществ, после удаления которых он вновь возвращается в свое исходное (нативное) состояние. Для высаливания белков используют соли щелочных и щелочноземельных металлов (наиболее часто в практике используют сульфат натрия и аммония). Эти соли удаляют водную оболочку (вызывают обезвоживание) и снимают заряд. Между величиной водной оболочки белковых молекул и концентрацией солей существует прямая зависимость: чем меньше гидратная оболочка, тем меньше требуется солей. Так, глобулины, имеющие крупные и тяжелые молекулы и небольшую водную оболочку, выпадают в осадок при неполном насыщении раствора солями, а альбумины как более мелкие молекулы, окруженные большой водной оболочкой, – при полном насыщении.

Нативная молекула белка

Денатурированная молекула белка. Черточки обозначают связи в молекуле нативного белка, разрывающиеся при денатурации

Необратимое осаждение связано с глубокими внутримолекулярными изменениями структуры белка, что приводит в потере ими нативных свойств (растворимости, биологической активности и др.). Такой белок называется денатурированным, а процесс денатурацией. Денатурация белков происходит в желудке, где имеется сильнокислая среда (рН 0,5 – 1,5), и это способствует расщеплению белков протеолитическими ферментами. Денатурация белков положена в основу лечения отравления тяжелыми металлами, когда больному вводят per os (“через рот”) молоко или сырые яйца с тем, чтобы металлы денатурируя белки молока или яиц. Адсорбировались на их поверхности и не действовали на белки слизистой оболочки желудка и кишечника, а также не всасывались в кровь. Размер белковых молекул лежит в пределах 1 мкм до 1 нм и, следовательно, они являются коллоидными частицами, которые в воде образуют коллоидные растворы. Эти растворы характеризуются высокой вязкостью, способностью рассеивать лучи видимого света, не проходят сквозь полупроницаемые мембраны. Вязкость раствора зависит от молекулярной массы и концентрации растворенного вещества. Чем выше молекулярная масса, тем раствор более вязкий. Белки как высокомолекулярные соединения образуют вязкие растворы. Например, раствор яичного белка в воде.

Вода

Коллоидные частицы не проходят через полупроницаемые мембраны (целлофан, коллоидную пленку), так как их поры меньше коллоидных частиц. Непроницаемыми для белка являются все биологические мембраны. Это свойство белковых растворов широко используется в медицине и химии для очистки белковых препаратов от посторонних примесей. Такой процесс разделения называется диализом. Явление диализа лежит в основе действия аппарата “искусственная почка”, который широко используется в медицине для лечения острой почечной недостаточности. Диализ (белые крупные кружки – молекулы белка, черные – молекулы хлористого натрия) Глава 6. Классификация белков Все белки в зависимости от строения делятся на простые – протеины, состоящие только из аминокислот, и сложные - протеиды, имеющих небелковую протеистическую группу.

6.1. Протеины

Протеины представляют собой простые белки, состоящие только из белковой части. Они широко распространены в животном и растительном мире. К ним относятся альбумины и глобулины, встречающиеся практически во всех животных и растительных клетках, биологических жидкостях и выполняющих важные биологические функции. Альбумины участвуют в поддержании осмотического давления крови (создают онкотическое давление), транспортируют с кровью различные вещества. Глобулины входят в состав ферментов, составляющих основу иммуноглобулинов, выполняющих функции антител. В сыворотке крови между этими двумя компонентами существует постоянное соотношение – альбумино-глобулиновый коэффициент (А/Г), равный 1,7 – 2,3 и имеющий важное диагностическое значение. Другими представителями протеинов являются протамины и гистоны – белки основного характера, содержащие много лизина и аргинина. Эти белки входят в состав нуклеопротеидов. Другой основной белок – коллаген – образует внеклеточное вещество соединительной ткани и находится в коже, хрящах и др. тканях.

6.2. Протеиды

Протеиды являются сложными белками, состоящими из белковой и небелковой частей. Название протеида определяется названием его простетической группы). Так, нуклеиновые кислоты являются небелковой частью нуклеопротеидов, фосфорная к-та входит в состав фосфопротеидов, углеводы – гликопротеидов, а липиды – липопротеидов. Нуклеопротеиды. Имеют важное значение, т.к. их небелковая часть представлена ДНК и РНК. Простетическая группа представлена в основном гистонами и протаминами. Такие комплексы ДНК с гистонами обнаружены в сперматозоидах, а с гистонами – в соматических клетках, где молекула ДНК “намотана” вокруг молекул гистонов. Нуклепротеидами по своей природе являются вне клетки вирусы – это комплексы вирусной нуклеиновой к-ты и белковой оболочки – капсида. Хромопротеиды. Являются сложными белками, простетическая группа которых представлена окрашенными соединениями. К хромопротеидам относятся гемоглобин, миоглобин (бело мышц), ряд ферментов (каталаза, пероксидаза, цитохромы), а также хлорофилл. Гемоглобин (Hb) состоит из белка глобина и небелковой части гема, включающего атом Fe(II), соединенный с протопорфирином. Молекула гемоглобина состоит из 4-х субъединиц: двух a и двух b и соответственно содержит четыре полипептидные цепочки двух сортов. Каждая a-цепочка содержит 141, а b-цепочка – 146 аминокислотных остатков. Атом железа может образовать шесть координационных связей. Четыре связи направлены к атомам азота пиррольных колец, оставшееся две связи – перпендикулярно к плоскости порфиринового кольца по обе его стороны. Гемы расположены вблизи поверхности белковой глобулы в специальных карманах, образованных складками полипептидных цепочек глобина. Гемоглобин при нормальном функционировании может находиться в одной из трех форм: феррогемоглобин (обычно называемый дезоксигемоглобином или просто гемоглобином), оксигемоглобин и ферригемоглобин (метгемоглобин). В ферригемоглобине железо находится в закисной форме Fe(II), одна из двух связей, перпендикулярных к плоскости порфиринового кольца, направлена к атому азота гистидинового остатка, называемого проксимальным (соседним), по другую сторону порфиринового кольца и на большем расстоянии от него находится другой гистидиновый остаток – дистальный гистидин, не связанный непосредственно с атомом железа. Взаимодействие молекулярного кислорода со свободным гемом приводит к необратимому окислению атома железа гема [Fe(II) Þ Fe(III); гем Þ гемин]. Поэтому в дезоксигемоглобине глобин предохраняет железо от окисления. | | CH2 CH2 | | H2C CH H2C CH O C C

N

N

N Fe N+ ¾ Fe ¾ O H CH H CH
Плоскость порфиринового кольца
Плоскость порфиринового кольца
При взаимодействии молекулярного кислорода с гемоглобином существует небольшая, но конечная вероятность окисления последнего: молекула O2 не присоединяется, но окислит железо: Fe2+ + O2 Þ Fe 3+ + O2. Поэтому при дыхании в эритроцитах непрерывно образуется метгемоглобин. Для его восстановления в эритроците существует специальная ферментативная система, восстанавливающая метгемоглобин и превращающая его в нормальный дезоксигемоглобин. При нарушении этой системы возникает тяжелое заболевание – метгемоглобинемия, при которой гемоглобин перестает быть переносчиком кислорода. Присоединение кислорода меняет кислотно-основные свойства гемоглобина. Оксигемоглоин является более сильной кислотой, чем дезоксигемоглобин. Поэтому в тканях, где значительная часть гемоглобина теряет кислород и становится более сильным основанием, гемоглобин связывает образующуюся в ходе метаболических внутриклеточных процессов углекислоту. В альвеолах легких дезоксигемоглобин снова превращается в оксигемоглобин, становится более сильной кислотой и способствует отщеплению CO2. Углекислота, освобождаемая тканями, недостаточно хорошо растворима для эффективного переноса. С помощью фермента карбоангидразы, ускоряющего прямую и обратную реакцию: CO2 + H2O Û HCO3 + H+, Двуокись углерода превращается в хорошо растворимый бикарбонат-анион. В капиллярах тканей отщепление кислорода повышает содержание дезоксигемоглобина, связывающего протоны и смещающего равновесие реакции вправо. Легко растворимый ион бикарбоната переносится кровью. В альвеолах легких гемоглобин оксигенируется, протоны освобождаются и равновесие смещается влево. Образуется плохо растворимая двуокись углерода CO2, которая удаляется из водной фазы и выдыхается. Таким образом, гемоглобин работает как буфер с переменным значением pH. Функция гемоглобина как переносчика углекислоты не менее важна, чем его функция переноса кислорода. Миоглобин. Хромопротеид, содержащийся в мышцах. Он состоит только из одной цепи, аналогичной субъединице гемоглобина. Миоглобин является дыхательным пигментом мышечной ткани. Он значительно легче гемоглобина связывается с кислородом, но труднее отдает его. Миоглобин создает запасы кислорода в мышцах, где его количество может достичь 14% всего кислорода организма. Это имеет важное значение, особенно для работы мышц сердца. Высокое содержание миоглобина обнаружено у морских млекопитающих (тюленя, моржа), что позволяет им длительное время находиться под водой. Гликопротеиды. Представляют собой сложные белки простетическая группа которых образована производными углеводов (аминосахарами, гексуроновыми кислотами). Гликопротеиды входят в состав клеточных мембран. Так, легочные стенки бактерий построены из пептидогликанов, являющихся производными линейных полисахаридов, несущих ковалентно связанные с ними пептидные фрагменты. Эти фрагменты осуществляют сшивание полисахаридных цепей с образованием механически прочной сетчатой структуры. Например, клеточная стенка E.coli построена из полисахаридных цепей, образованных остатками N-ацетилглюкозамина, связанными b-(1®4)связями, причем каждый второй остаток несет присоединенный к нему по атому С3 фрагмент, образованный связанными амидными связями остатками молочной кислоты, L-аланина, D-глутамата (через g-карбоксил), мезодиаминонимелината и D-аланина:

O O
OH
O O O

O

CH NHCOCH3 NHCOCH3 H3C CO – L-Ala – D-Glu – NH – CHCH2CH2CH2CHCO – D-Ala(CO) – | | COO NH | Каждая С-концевая группа этого пептида, принадлежащая остатку D-аланина, образует амидную связь с аминогруппой остатка диаминонимиелиновой кислоты, принадлежащей соседней полисахаридной цепи. Кроме вышеприведенной функции гликопротеиды участвуют в транспорте различных веществ, в процессах свертывания крови, иммунитета, являются составными частями слизи и секретов желудочно-кишечного тракта. У арктических рыб гликопротеиды играют роль антифризов – веществ, препятствующих образованию кристаллов льда внутри их организма. Фосфопротеиды. Имеют в качестве небелкового компонента фосфорную к-ту. Представителями данных белков являются казеиноген молока, вителлин (белок желтков яиц), ихтулин (белок икры рыб). Такая локализация фосфопротеидов свидетельствует о важном их значении для развивающегося организма. У взрослых форм эти белки присутствуют в костной и нервной тканях. Липопротеиды. Сложные белки, простетическая группа которых образована липидами. По строению это небольшого размера (150-200 нм) сферические частицы, наружная оболочка которых образована белками (что позволяет им передвигаться по крови), а внутренняя часть – липидами и их производными. Основная функция липопротеидов – транспорт по крови липидов. В зависимости от количества белка и липидов, липопротеиды подразделяются на хиломикроны, липопротеиды низкой плотности (ЛПНП) и высокой плотности (ЛПВП), которые иногда обозначаются как a- и b-липопротеиды. Хиломикроны являются наиболее крупными из липопротеидов и содержат до 98-99% липидов и только 1-2% белка. Они образуются в слизистой оболочки кишечника и обеспечивают транспорт липидов из кишечника в лимфу, а затем в кровь. В ЛПНП количество белка составляет 9-20% , а среди липидов преобладают холестерин и триацилглицерины (до 40%). Белковая часть ЛПВП колеблется в пределах 35-50%, а белковая представлена фосфолипидами и холестерином. Таким образом, холестерин транспортируется по крови в составе липопротеидов, особенно ЛПНП. Глава 7. Методы исследования белков Среди методов, используемых в биохимии, ключевое значение имеют выделение веществ из биологических источников и, как правило, их очистка с целью получения индивидуальных соединений. Следует отметить три главные проблемы выделения в индивидуальном виде компонентов из живых организмов: 1) Исходный материал - биомасса состоит из многих сотен и даже тысяч различных соединений. Разделение таких смесей чрезвычайно сложно, кроме того многие компоненты этих смесей построены довольно однотипно (например, иммуноглобулины). В связи с этим они мало различаются между собой по физико- химическим характеристикам - растворимости или способности к сорбции на определенном типе сорбента. 2) Работа с биохимическими объектами зачастую сопровождается необходимостью манипулировать с очень небольшими количествами исходного вещества. При ничтожно малом количестве используемого материала методы их детекции должны быть высокочувствительными. Такими методами являются спектрофотометрические методы, основанные на измерении поглощения видимого или ультрафиолетового света, радиохимические методы, основанные на изменении радиоактивности, и люминесцентные, основанные на изменении флуоресценции, био- и хемилюминесценции. 3) Многие компоненты обладают очень низкой устойчивостью. Часто задача состоит в том, чтобы выделить белок в нативном, т.е. сохраняющим биологическую активность состоянии. Между тем многие белки при умеренных температурах и незначительных изменениях рН среды подвержены денатурации, которая обычно сопровождается потерей биологической активности - инактивацией. Кроме того, в клетках часто имеются ферменты (в неповрежденных клетках в лизосомах) способные разрушить те или иные вещества, в первую очередь белки. 7.1. Традиционные методы выделения и очистки белков Все методы разделения смесей основаны на том, что разделяемые компоненты в результате каких-либо манипуляций оказываются в разных участках системы и могут быть механически отделены друг от друга. Выделение индивидуальных белков является ступенчатым процессом, т.к. на первых этапах очистки фракции содержат множество примесей. На каждой ступени разделения должна получаться фракция, более богатая необходимым веществом, чем предыдущая. Такой процесс часто называют фракционированием. На каждой стадии разделения белок находится либо в виде раствора, либо в виде осадка. 1) Осаждение. Для осаждения необходимо понизить каким-либо способом растворимость белка. Как уже говорилось в гл.5, стр.22 растворимость белка зависит от их способности к гидратации. У глобулярных водорастворимых белков высокий уровень гидратации обеспечивается расположением гидрофильных групп на поверхности. Добавление органических растворителей понижает степень гидратации и приводит к осаждению белка. В качестве таких растворителей используют ацетон. Осаждают белки также с помощью солей, например, сульфата аммония. Принцип этого метода основан на том, что при повышении концентрации соли в растворе происходит сжатие ионных атмосфер, образуемых противоионами белка, что способствует сближению их до критического расстояния, на котором межмолекулярные силы ван-дер-ваальсова притяжения перевешивают кулоновские силы отталкивания противоионов. Это приводит к слипанию белковых частиц и их выпадению в осадок. 2) Изоэлектрическое осаждение. Заряд белков обусловлен в первую очередь остатками аспаратата и глутамата (отрицательный заряд) и остатками лизина и аргинина (положительный заряд). По мере повышения рН различными способами заряд белков проходит от положительных к отрицательным значениям и в изоэлектрической точке оказывается равен нулю. В результате белок лишается своей ионной атмосферы и его частицы слипаются, выпадая в осадок. 3) Центрифугирование. Выпавший осадок белка можно выделить фильтрованием. Для этого часто пользуются центрифугами. Частицы осажденного вещества под действием центробежной силы оседают на дне центрифужных стаканов и сжимаются в плотный осадок, с которого оставшийся раствор (надосадочная жидкость, или супернатант) легко сливается или отсасывается. Скоростные центрифуги (ультрацентрифуги) создают центробежное ускорение порядка 105g (т.е. 105 ускорений свободного падения), что позволяет осаждать даже некоторые крупные надмолекулярные агрегаты - рибосомы и вирусы. 4) Сорбция. Основана на различном сродстве компонентов смесей к определенным веществам - сорбентам. Наиболее часто используемый сорбент - гель фосфата кальция (гидроксиапатит) или активированный уголь. Эффективную сорбцию можно получить на ионитах - сорбентах, имеющих на поверхности заряженные группы. В исходном состоянии эти заряды скомпенсированы какими-либо подвижными противоионами. Практически при сорбции на ионитах происходит обмен этих противоионов. Если на поверхности сорбента находятся отрицательно заряженные группы, то он связывает катионы и его называют катионитом, соответственно сорбент с положительно заряженными группами называют анионитом. В качестве ионитов чаще всего используют материалы (после соответствующей химической обработки) на гидрофильной основе - целлюлозе, декстране, силикагеле или пористых стеклах. 5) Ситовой эффект. Молекулярные сита представляют собой материалы с очень маленькими порами определенного размера. Следует отметить отличие этих “сит”: крупные частицы не остаются на поверхности материала сита, а обтекают его частички (гранулы), тогда как мелкие вещества примесей диффундируют в частицы сита и таким образом задерживаются. Материалом для молекулярных сит может служить сефадекс (полисахарид декстран, у которого после соответствующей обработки цепи оказываются сшитыми трехуглеродными мостиками) или полиакриламид, линейные цепи которого сшиты метиленовыми мостиками. В перечисленных методах в конечной смеси остаются вспомогательные низкомолекулярные вещества - органические растворители, соли и кислоты. Для очищения от них используется метод диализа, упоминавшийся в главе “Свойства белков”. Диализ основан на применении мембран проницаемых для воды и низкомолекулярных веществ и непроницаемых для белков. Чаще всего с этой целью используют пленки из целлофана (нитрат целлюлозы). В лаборатории подлежащий диализу раствор белка помещают в мешок из целлофана и погружаю последний в сосуд с водой. Непрерывный ток воды через сосуд приводит к полному переходу в него всех проходящих через целлофан веществ, а белки остаются внутри (см. иллюстрацию к гл.5). 7.2. Методы зонального разделения Эти методы основаны на том, что создается некоторая система, в которой компоненты смеси перемещаются с различными скоростями. Если в такую систему ввести разделяемую смесь в виде некоторой зоны, то по мере ее перемещения компоненты смеси, движущиеся с разными скоростями, будут формировать отдельные зоны, которые затем можно разнести в разные приемники. 1) Хроматография. При разделении белков и их анализе используется жидкостная хроматография. В жидкостной хроматографии зона разделяемых веществ с помощью тока элюирующей (вымывающей) жидкости перемещается относительно неподвижной фазы, которая обладает разным сродством к разделяемым компонентам. При перемещении зоны с помощью тока элюента каждый из разделяемых компонентов проводит некоторую часть времени на неподвижной фазе. Чем больше это время, тем медленнее перемещается зона с разделяемой смесью. В зависимости от природы физико-химического явления, лежащего в основе разделения веществ, различают адсорбционную, ионообменную, распределительную и гель-хроматографию (эксклюзивную хроматографию). В адсорбционной чаще всего используют оксид алюминия в качестве неподвижной фазы. В ионообменной используются те же типы ионитов, что в ионообменной сорбции. Распределительная хроматогрфия основана на разделении веществ между двумя несмешивающимися жидкими фазами. Неподвижная жидкая фаза образуется в результате ее закрепления на пористом нерастворимом носителе. В гель 2) Электрофорез. В этом случае зоны создаются в результате того, что разные компоненты смеси с различной скоростью перемещаются в электрическом поле. После специальной обработки разделяемые смеси наносят на гель (декстроновый, полиакриламидный, или другой) а затем подключают но определенное время постоянный электрический ток. Белки в зависимости от своей молекулярной массы и заряда начинают двигаться с различной скоростью. После отключения тока гель помещают в специальный раствор, где интересующие исследователя белки окрашиваются. Существует электрофорез в растворе, но он имеет ограниченное применение, т.к. исследуемые белки часто подвергаются значительному диффузионному размыванию. Однако сейчас стало возможным применять этот метод в условиях невесомости в космосе, что устраняет конвекционные токи, обуславливающие диффузионную размывку. Все описанные выше методы зонального разделения являются одномерными, разделение в них происходит в одной координате. Наряду с этим применяются двумерные системы разделения на пластинах. При этом разделяемую смесь в виде пятна наносят на один из углов и разделяют в одном направлении. Затем какие-либо параметры, определяющие разделяющую способность системы изменяют и проводят разделение в перпендикулярном направлении. При удачном подборе системы и условий разделения удается разделить те компоненты, которые не разделились при первой процедуре. Комбинации методов могут быть довольно разнообразны: двумерная хроматография с использованием в разных направлениях разных элюентов, хроматография в одном и электрофорез в другом направлениях. 7.3. Определение первичной структуры белков Определение первичной структуры белков сводится к выяснению порядка расположения аминокислот в полипептидной цепочке. Эту задачу решают с помощью метода секвенирования (от англ. sequence - последовательность). Собственно секвенирование на его сегодняшнем уровне позволяет определить аминокислотную последовательность а полипептидах, размер которых не превышает несколько десятков аминокислотных остатков. В то же время исследуемые полипептидные фрагменты значительно короче тех природных белков, с которыми приходится иметь дело. Поэтому необходимо предварительное разрезание исходного полипептида на короткие фрагменты. После секвенирования полученных фрагментов их необходимо снова сшить в первоначальной последовательности. Таким образом определение первичной последовательности белка сводится к следующим основным этапам: 1) Расщепление белка на несколько фрагментов длиной, доступной для секвенирования. 2) Секвенирование каждого из полученных фрагментов. 3) Сборка полной структуры белка из установленных структур его фрагментов. Для специфического расщепления белков по определенным точкам применяются как ферментативные, так и химические методы. Из ферментов, катализирующих гидролиз белков по определенным точкам, наиболее широко используют трипсин и химотрипсин. Трипсин катализирует гидролиз пептидных связей, расположенных после остатков лизина и аргинина. Химотрипсин преимущественно расщепляет белки после остатков ароматических аминокислот - фенилаланина, тирозина и триптофана. При необходимости специфичность трипсина может быть повышена или изменена. Например, обработка цитраконовым ангидридом исследуемого белка приводит к ацилированию остатков лизина. В таком модифицированном белке расщепление будет проходить только по остаткам аргинина. Наряду с ферментативными методами используются и химические методы расщепления белков. Для этой цели часто применяют бромциан, расщепляющий белок по остаткам метионина:

H+

Секвенирование проводят методом, известным как метод Эдмана. Последовательная обработка полипептида, имеющего свободную концевую a-аминогруппу, каким-либо алкил- или арилизотиоцианатом в слабощелочной среде приводит к образованию соответствующей тиомочевины, которая в умеренно кислой среде приводит (при значениях кислотности, не повреждающих пептидной связи) отщепляется в виде соответствующего тиогидантоина. Оригинальная процедура Эдмана основана на использовании фенилизотиоцианата и тем самым на образовании фенилтиогидантоинов:

В результате образуется фенилтиогидантоин, содержащий боковой радикал аминокислоты R1, который может быть идентифицирован путем измерения какой-либо физической или физико-химической характеристики, позволяющей различать гидантоины, соответствующие разным входящим в состав белков аминокислотам. В качестве такой характеристики может служить хроматографическая подвижность в какой-либо предварительно проградуированной по стандартным образцам гидантоинов системе или молекулярная масса, определяемая с помощью масс-спектрометра. Превращение N-концевого аминокислотного остатка в тиогидантоин приводит к укорочению анализируемой полипептидной цепи на одно звено. Выделив этот пептид, исследователь получает возможность повторить всю процедуру, установить природу второго аминокислотного остатка и выделить полипептид, укороченный на два звена. Многократное повторение такой ступенчатой деградации дает возможность последовательно идентифицировать все составляющие исходный полипептид остатки аминокислот, т.е. установить его первичную структуру. Практически метод Эдмана позволяет сделать один-два десятка шагов. Работа сводится к многократному повторению одних и тех же чередующихся процедур: добавления изотиоцианата, отщепления тиогидантоина, отделения его от укороченного пептида для последующей идентификации, выделение оставшегося полипептида в виде пригодном для следующего шага обработки. Чтобы избавить исследователей от такой монотонной работы, требующей вместе с тем строгого соблюдения условий эксперимента на каждом шаге, созданы специальные автоматизированные установки для проведения вех перечисленных операций - автоматические секвенаторы полипептидов. С их помощью удается произвести до 40 - 60 шагов ступенчатой деградации. Завершающим этапом установления первичной структуры белка является восстановление порядка, в котором просеквенированные фрагменты располагались в исходном полипептиде. Чаще всего для этой цели исползуют подход изветный как метод перекрывающихся белков. Ниже излагается основная идея метода. Если установлена структура всех полипептидов, полученных расщеплением исследуемого белка с помощью трипсина (далее такие полипептиды обозначаются буквой Т - от слова “трипсиновые”), то остается определить для каждого из этих пептидов, с какими двумя Т-пептидами он соседствует с N- и С-конца. В структуре просеквенированных Т-пептидов такая информация полностью отсутствует. Однако ее можно частично, а в ряде случаев и полностью восстановить, если располагать аналогичными данными для серии полипептидов, полученных расщеплением того же исследуемого белка по какой-либо другой группе аминокислотных остатков. Для определенности ниже речь будет идти о полипептидах, полученных расщеплением химотрипсином (пептиды группы С, chymotryptic). Как видно из рисунка, если два Т-пептида являются соседними в исходной цепи, то существует С-пептид, который либо содержит в своем составе полностью оба или один из рассматриваемых Т-пептидов, либо как минимум содержит С-концевую часть левого и N-концевую часть правого пептида группы Т. этот С-пептид перекрывает два соседних Т-пептида, с чем и связано название метода. Таким образом, просматривая структуры пептидов Т и С, можно для любой пары Т- пептидов выявить, являются ли они соседями в исследуемом белке или разделены одним или несколькими другими Т-пептидами. Неоднозначность может появиться только в том случае, если перекрываемый каким-либо из С-петидов концевой фрагмент встречается у двух или нескольких Т-пептидов. Вероятность этого как правило невелика. Если это все же происходит, то применяют более сложные методы комбинаторики. Глава 8. Химический синтез полипептидов и белков Химический синтез полипептидов и белков имеет большое практическое и теоретическое значение. В практическом отношении важны белковые гормоны - инсулин и вазопрессин, в настоящее время получаемые синтетическим путем. Интересны и имеют практическое применение пептиды группы пептидов мозга: метионин-энкефалин (Tyr-Gly-Gly-Phe-Met) и лейцин-энкефалин (Tyr-Gly-Gly-Phe- Leu). Эти соединения оказывают на мозговые центры такое же действие, как и морфин. Таким образом они могут применяться в качестве анальгетика, однако они практически не вызывают привыкания. Традиционные методы синтеза регулярных полимеров позволяют получить сополимеры, состоящие из двух (или более) сходных типов мономеров со статистическим распределением их по цепи, в том числе белков. В частности, возможно получение гомополимеров или статистических сополимеров, состоящих из аминокислотных остатков, связанных пептидными связями (полиаминокислот). В качестве примера можно привести процесс получения полиаминокислот, основанный на конденсации N-карбоксиангидридов аминокислот, образуемых из соответствующих аминокислот обработкой фосгеном:

Эти соединения содержат электрофильную ангидридную группу, которая может атаковать алифатическую аминогруппу аминокислоты, используемой в качестве затравки, с выделением СО2 и одновременном освобождением новой аминогруппы из атакующей молекулы N-карбоксиангидрида, таким образом открывая возможность поликонденсации: Нетрудно заметить, что каждая стадия поликонденсации (с учетом реакции образования N-карбоксиангидридов аминокислот) сопровождается превращением молекулы COCl2 в CO2 и 2HCl, что термодинамически выгодно и является источником свободной энергии для образования пептидной связи. При синтезе нерегулярных полипептидов базируются также на активации карбоксильных групп. Большинство из них базируется на использовании N,N-дициклогексилкарбодиимида (ДЦК). Он способен в присутствии RCOO- и амина NH2R’ осуществить активацию карбоксильных групп:

Промежуточнам соединением является O-ацил-N,N’-дициклогексилмочевину (ДЦМ): Обычно ДЦК в пептидном синтезе используется не непосредственно, а для синтеза стабильных реакционноспособных производных аминокислот, ангидридов или активированных эфиров путем реакции с соответствующими гидроксисоединениями:

Вследствие нуклеофильного характера, должны содержать сильный электронный акцептор Х.

NH2CHR1C(O)-NHCHR2C(O)-OX

Тем не менее эти соединения нельзя непосредственно использовать для синтеза пептидов определенной структуры. Смешивая две аминокислоты с активированными карбоксильными группами, можно получить четыре разных дипептида:

NH2CHR1C(O)-OX + NH2CHR1C(O)-OX

Более того из-за наличия активных групп процесс может идти дальше. Но в результате получается только статистический полимер.

NH2CHR1C(O)-NHCHR2CОО-

Для предотвращения образования лишних полипептидов необходимо исключить участие в процессе аминогруппы первой аминокислоты и активированной аминогруппы второй (в результате получается пептид ). Это достигается использованием защитных групп Z на тех функциональных группах, которые не должны вступать во взаимодействие. Реакция Должна приводить к одному определенному дипипептиду. Этот пептид нереакционноспособен и для продолжения процесса необходимо удалить одну из защитных групп Z1,Z2, для того чтобы открыть либо NH 2, либо СООН-группу для следующей стадии удлинения пептидной цепи. Поэтому главным требованием к защитным группам является возможность их мягкого селективного удаления, не повреждающего пептидную связь. Наиболее широко для защиты a-аминогрупп используется трет-бутилоксикарбонильная группа (Вос), которую легко ввести в аминогруппу обработкой аминокислоты соответствующим N-гидроксисукциниимидным эфиром:

+H+

Эту группу легко удалить слабой кислотной обработкой пептида, при которой эта связь не разрушается:

+ NH2CHR1C(O)-NHCHR2C(O)-Z2

В качестве группы Z2 используют эфирные группы, которые стабильны в кислой среде в условиях проведения синтеза и могут быть селективно удалены мягкой щелочной обработкой. Специфической особенностью полипептидного синтеза является огромное число идентичных стадий, которые необходимо проводить на каждом этапе: образование новой пептидной связи, удаление защитной группы для подготовки к следующей стадии элонгации (удлинения) цепи и промежуточные отмывки от избытка реагентов и побочных продуктов после каждого химического превращения. метод, разработанный Р.Меррифилдом, дал возможность автоматизировать этот процесс и снизить механические потери. Согласно этому методу, первый мономер во вновь строящейся цепи синтезируемого полипептида ковалентно связывается с нерастворимым носителем (смолой - сополимер стиролдивинилбензола) и все последующие стадии проводятся с полипептидом, растущим на этой смоле. Этот метод известен как твердофазный синтез полипептидов. К смоле попеременно добавляют очередной синтон (мономер, содержащий набор защитных групп и в ряде случаев активированные остатки) и реагент для удаления концевой защитной группы (обычно в остаток). Химические стадии сопровождаются соответствующими промывками. В течение всего процесса пептид остается связанным со смолой. Поместив в колонку смолу, с которой связан синтезируемый полипептид, можно легко автоматизировать процесс, запрограммировав смену потоков через колонку: синтон (мономер) - растворитель - смесь для удаления защиты - растворитель и т.д. разработаны специальные приборы для автоматизированного полипептидного синтеза. Применение такого прибора позволяет получить такие сложные полипептиды, как 99-членный полипептид - протеазу, кодированную ВИЧ-1. Эта протеаза нужна для протеолитического разрезания больших полипептидов, образовавшихся при трансляции (белковом синтезе) вирусных и-РНК. Огромный интерес к этой протеазе обусловлен надеждой найти специфические ингибиторы замедляющие работу этого фермента и следовательно предотвратить образование вирусных частиц. Для синтеза приведенной выше протеазы на автоматическом пептидном синтезаторе “Applied Biosystem” потребовалось около 200 химических процедур, не считая промывок, предшествующих каждой смене реагента. На завершающей стадии защищенный полипептид, ковалентно связанный со смолой, снимается с нее и защитные группы удаляются соответствующими обработками. Глава 9. Биологические функции белков Функции белков чрезвычайно многообразны. Каждый данный белок как вещество с определенным химическим строением выполняет одну узкоспециализированную функцию и лишь в нескольких отдельных случаях – несколько взаимосвязанных. Например, гормон мозгового слоя надпочечников адреналин, поступая в кровь, повышает потребление кислорода и артериальное давление, содержание сахара в крови, стимулирует обмен веществ, а также является медиатором нервной системы у холоднокровных животных.

1) Каталитическая (ферментативная) функция: Многочисленные биохимические реакции в живых ганизмах протекают в мягких условиях при температурах, близких к 40°С, и значениях рН близких к нейтральным. В этих условиях скорости протекания большинства реакций ничтожно малы, поэтому для их приемлемого осуществления необходимы специальные биологические катализаторы – ферменты. Даже такая простая реакция, как дегидратация угольной к-ты: CO2 + H2O HCO3-+ H+ катализируется ферментом карбоангидразой. Вообще все реакции, за исключением реакции фотолиза воды 2H2O®4H+ + 4e- + O2, в живых организмах катализируются ферментами. Как правило, ферменты – это либо белки, либо комплексы белков с каким-либо кофактором – ионом металла или специальной органической молекулой. Ферменты обладают высокой, иногда уникальной, избирательностью действия. Например, ферменты, катализирующие присоединение a-аминокислот к соответствующим т-РНК в процессе биосинтеза белка, катализируют присоединение только L-аминокислот и не катализируют присоединение D-аминокислот. 2) Транспортная функция белков: Внутрь клетки должны поступать многочисленные вещества, обеспечивающие ее строительным материалом и энергией. В то же время все биологические мембраны построены по единому принципу – двойной слой липидов, в который погружены различные белки, причем гидрофильные участки макромолекул сосредоточены на поверхности мембран, а гидрофобные “хвосты” – в толще мембраны. Такая структура непроницаема для таких важных компонентов, как сахара, аминокислоты, ионы щелочных металлов. Их проникновение внутрь клетки осуществляется с помощью специальных транспортных белков, вмонтированных в мембрану клеток. Например, у бактерий имеется специальный белок, обеспечивающий перенос через наружную мембрану молочного сахара – лактозы. Лактоза по международной номенклатуре обозначается b-галаткозид, поэтому транспортный белок называют b-галактозидпермеазой. Важным примером транспорта веществ через биологические мембраны против градиента концентрации является Na-K-ый насос. В ходе его работы происходит перенос трех положительных ионов Na+ из клетки на каждые два положительных иона K + в клетку. Эта работа сопровождается накоплением электрической разности потенциалов на мембране клетки. При этом расщепляется АТФ, давая энергию. Молекулярная основа натрий-калиевого насоса была открыта недавно, это оказался фермент, расщепляющий АТФ, – натрий-калийзависимая АТФ-аза. Насос действует по принципу открывающихся и закрывающихся каналов. Связывание молекул “канального” белка с ионом натрия приводит к нарушению системы водородных связей, в результате чего меняется его конформация. Обычная a-спираль, в которой на каждый виток приходится по 3,6 аминокислотного остатка, переходит в более “рыхлую” p-спираль (4,4 аминокислотного остатка). В результате образуется внутренняя полость, достаточная для прохождения иона натрия, но слишком узкая для иона калия. После прохождения Na+ p-спираль переходит в туго свернутую 310-спираль (на один виток 3 аминокислотных остатка, а водородная связь – у каждого 10-го атома). При этом натриевый канал закрывается, а стенки соседнего калиевого канала расширяются, ионы калия проходят по ним в клетку. Натрий-калиевый насос работает по принципу перистальтического насоса (напоминает продвижение пищевого комка по кишечнику), принцип действия которого основан на переменном сжатии и расширении эластичных труб. У многоклеточных организмов существует система транспорта веществ от одних органов к другим. В первую очередь это уже упоминавшийся в гл.6 (стр.26) гемоглобин. Кроме того, в плазме крови постоянно находится транспортный белок – сывороточный альбумин. Этот белок обладает уникальной способностью образовывать прочный комплексы с жирными кислотами, образующимися при переваривании жиров, с некоторыми гидрофобными аминокислотами (например, с триптофаном), со стероидными гормонами, а также со многими лекарственными препаратами, такими, как аспирин, сульфаниламиды, некоторые пенициллины. В качестве еще одного распространенного примера белка-переносчика можно привести трансферрин (обеспечивает перенос ионов железа) и церуплазмин (переносчик ионов меди). 3) Рецепторная функция: Большое значение, в особенности для функционирования многоклеточных организмов, имеют белки-рецепторы, вмонтированные в плазматическую мембрану клеток и служащие для восприятия и преобразования различных сигналов, поступающих в клетку, как от окружающей среды, так и от других клеток. В качестве наиболее исследованных можно привести рецепторы ацетилхолина, находящиеся на мембране клеток в ряде межнейронных контактов, в том числе в коре головного мозга, и у нервно-мышечных соединений. Эти белки специфично взаимодействуют с ацетилхолином CH3C(O) – OCH2CH2N+ (CH3)3 и отвечает на это передачей сигнала внутрь клетки. После получения и преобразования сигнала нейромедиатор должен быть удален, чтобы клетка подготовилась к восприятию следующего сигнала. Для этого служит специальный фермент – ацетилхолинэстераза, катализирующая гидролиз ацетилхолина до ацетата и холина. Многие гормоны не проникают внутрь клеток-мишеней, а связываются со специфическими рецепторами на поверхности этих клеток. Такое связывание является сигналом, запускающим в клетке физиологические процессы. Примером является действие гормона инсулина в аденилатциклазной системе. Рецептор к инсулину представляет собой гликопротеид, пронизывающий плазмалемму. При связывании гормона с рецепторной частью этого сложного белка в нем происходит активация каталитической внутренней части, представляющей фермент аденилатциклазу. Этот фермент синтезирует из АТФ циклическую аденозинмонофосфорную к-ту (цАМФ), которая в свою очередь катализирует ключевую стадию окисления полисахаридов – превращение гликогена в мономерное производное глюкозы глюкозо-1-фосфат, который далее подвергается окислительной деструкции, сопровождающейся фосфорилированием большого количества АДФ. 4) Защитная функция: Иммунная система обладает способностью отвечать на появление чужеродных частиц выработкой огромного числа лимфоцитов, способных специфически повреждать именно эти частицы, которыми могут быть чужеродные клетки, например патогенные бактерии, раковые клетки, надмолекулярные частицы, такие как вирусы, макромолекулы, включая чужеродные белки. Одна из групп лимфоцитов – В-лимфоциты, вырабатывает особые белки, выделяемые в кровеносную систему, которые узнают чужеродные частицы, образуя при этом высокоспецифичный комплекс на этой стадии уничтожения. Эти белки называются иммуноглобулины. Чужеродные вещества, вызывающие иммунный ответ называют антигенами, а соответствующие к ним иммуноглобулины – антителами. Если в роли антигена выступает большая молекула, например, молекула белка, то антитело опознает не всю молекулу, а ее определенный участок, называемый антигенной детерминантой. Тот факт, что иммуноглобулины взаимодействуют со сравнительно небольшой частью полимерного антигена, позволяет вырабатывать антитела, специфично узнающие некоторые небольшие молекулы, не встречающиеся в живой природе. Классический пример – динитрофенильный остаток. При введении экспериментальным животным конъюгата динитрофенола с каким-либо белком начинается выработка антител, специфично узнающих различные производные динитрофенола. Но при введении чистого динитрофенола, иммунного ответа нет. Такие вещества, способные служить антигенными детерминантами, но сами не способные вызвать иммунный ответ, называются гаптенами. Антитела построены из четырех полипептидных цепей, связанных между собой дисульфидными мостиками. Упрощенная схема строения иммуноглобулина класса G представлена на следующем рисунке. Две полипептидные цепи имеют размер порядка 200 аминокислотных остатков и называются легкими цепями (L-цепи). Две другие вдвое больше по размеру и называются тяжелыми цепями (H-цепи). На N-конце обеих цепей имеется вариабельная область размером немногим более 100 аминокислотных остатков, которая различна у иммуноглобулинов, настроенных на разные антигены – именно она определяет специфичность данной популяции лимфоцитов.

Вариабелная об-ласть формирует центр, непосред-ственно связыва-ющийся с опреде-ленным антиге-ном или гаптеном остальная часть, составляющая у легкой цепи поло-вину молекулы, а у тяжелой – ¾ , не зависит от вида иммуноглобу-лина. Эта область назы-вается кон-стантной.

Подпись: S

СH СH

Подпись: S

S
S
СL СL
S
S
СH2 СH2

S
S
СH3 СH3 Подпись: Схема строения молекулы иммуноглобу-лина: Н-цепь – тяжелая цепь, L-цепь – лег-кая цепь, VH  и VL – вариабельные участки тяжелой и легкой цепей. Согласно современным представ-лениям, каждый тип иммуногло-булина вырабатывается группой В-лимфоцитов, произошедших от одного общего предшественника. Такую группу лимфоцитов называют клоном. Первые успехи в изучении строения иммуноглобулинов были связаны с изучением иммуноглобулинов, полученных от больных миеломой (патология, связанная со сверхпродукцией определенного вида иммуноглобулинов). У больных, от одного злокачественно разросшегося клона В-лимфоцитов, вырабатывается огромное количество индивидуального иммуноглобулина, который сравнительно легко отделить от остальных. Далее производили слияние клеток миеломы как носителей способности к неограниченному размножению с нормальными В-лимфоцитами как носителями программы выработки антител определенной, задаваемой экспериментатором специфичности. Получающиеся клетки, гибридомы сохраняют способность к неограниченному размножению и вырабатывают при этом только определенные антитела. Так как гибридомы происходят из одной слитой клетки, то они представляют собой единый клон; получающиеся из них антитела поэтому называют моноклональными антителами (МАТ). 5) Структурная функция: Наряду с белками, выполняющими тонкие высокоспециализирован-ные функции, существуют белки, имеющие в основном структурное значение. Они обеспечивают механическую прочность и другие механические свойства отдельных тканей живых организмов. В первую очередь это коллаген - основной белковый компонент внеклеточного матрикса соединительной ткани. У млекопитающих коллаген составляет до 25% общей массы белков. Коллаген синтезируется в фибробластах - основных клетках соединительной ткани. Первоначально он образуется в виде проколлагена - предшественника, который проходит в фибробластах определенную химическую обработку, состоящую в окислении остатков пролина до гидроксипролина и некоторых остатков лизина до d-гидроксилизина. Коллаген формируется в виде трех скрученных в спираль полипептидных цепей, которые уже вне фибробластов объединяются в коллагеновые фибриллы диаметром несколько сотен нанометров, а последние - уже в видимые под микроскопом коллагеновые нити. В эластичных тканях - коже, стенках кровеносных сосудов, легких - помимо коллагена внеклеточный матрикс содержит белок эластин, способный довольно в широких пределах растягиваться и возвращаться в исходное состояние. Еще один пример структурного белка - фиброин шелка, выделяемый гусеницами шелкопряда в период формирования куколки и являющийся основным компонентом шелковых нитей. 6) Двигательные белки Мышечное сокращение является процессом, в ходе которого происходит превращение химической энергии, запасенной в виде макроэргических пирофосфатных связей в молекулах АТФ, в механическую работу. Непосредственными участниками процесса сокращения являются два белка - актин и миозин. Миозин представляет собой белок необычного строения, состоящий из длинной нитевидной части (хвост) и двух глобулярных головок. Общая длина одной молекулы составляет порядка 1600 нм, из которых на долю головок приходится около 200 нм. Миозин обычно выделяется в виде гексамера, образованного двумя одинаковыми полипептидными цепями с молекулярной массой 200 000 каждая (“тяжелые цепи”) и четырьмя “легкими цепями” с молекулярной массой около 20 000. Тяжелые цепи закручены спиралью одна вокруг другой, образуя хвост, и несут на одном конце глобулярные головки, ассоциированные с легкими цепями. На головках миозина находится два важных функциональных центра - каталитический центр, способный в определенных условиях осуществлять гидролитическое расщепление b-g-пирофосфатной связи АТФ, и центр, обеспечивающий способность специфично связываться с другим мышечным белком - актином. Актин является глобулярным белком с молекулярной массой 42 000. В таком виде его называют G-актином. Однако он обладает способностью полимеризоваться, образуя длинную структуру, называемую F-актином. В такой форме актин способен взаимодействовать с головкой миозина, причем важной чертой этого процесса является зависимость от присутствия АТФ. При достаточно высокой концентрации АТФ комплекс, образованный актином и миозином, разрушается. После того как под действием миозиновой АТФазы (фермент) произойдет гидролиз АТФ, комплекс снова восстанавливается. Этот процесс легко наблюдать в растворе, содержащем оба белка. В отсутствии АТФ в результате образования высокомолекулярного комплекса раствор становится вязким. При добавлении АТФ вязкость резко понижается в результате разрушения комплекса, а затем начинает постепенно восстанавливаться по мере гидролиза АТФ. Эти взаимодействия играют важную роль в процессе мышечного сокращения. 7) Антибиотики: Большую и чрезвычайно важную в практическом отношении группу природных органических соединений составляют антибиотики - вещества микробного происхождения, выделяемые специальными видами микроорганизмов и подавляющие рост других, конкурирующих микроорганизмов. Открытие и применение антибиотиков произвело в 40-ые гг. революцию в лечении инфекционных заболеваний, вызываемых бактериями. Следует отметить, что на вирусы в большинстве случаев антибиотики не действуют и применение их в качестве противовирусных препаратов неэффективно. Первыми в практику были введены антибиотики группы пенициллина. Примерами их могут служить бензилпенициллин и ампициллин:

CH3

CH3

N

N

Сходны с ним по строению антибиотики группы цефалоспоринов, примером которых может служить цефамицин С. Общим у этих антибиотиков является наличие b-лактамного кольца. Механизм действия их состоит в торможении одной из стадий формирования муреина - пептидогликана, формирующего клеточную стенку бактерий.

Антибиотики чрезвычайно многообразны по своей химической природе и по механизму действия. Некоторые из широко используемых антибиотиков взаимодействуют с рибосомами бактерий, тормозя синтез белка в бактериальных рибосомах, в то же время практически не взаимодействуют с эукариотическими рибосомами. Поэтому они губительны для бактериальных клеток и мало токсичны для человека и животных. К их числу относятся хорошо известные стрептомицин, хлорамфеникол (левомицетин):

H3C

OH

NH

CHO

CH2OH

OH

О

OH

Левомицетин

Еще одним известным антибиотиком является тетрациклин:

Один из самых эффективных противотуберкулезных препаратов - антибиотик рифампицин - блокирует работу прокариотических РНК-полимераз - ферментов, катализирующих биосинтез РНК, - связываясь ферментом, но в то же время не обладает способностью связываться с РНК-полимеразами эукариот:

Интенсивно исследуются антибиотики, взаимодействующие с ДНК и этим нарушающие процессы, связанные с реализацией заложенной в ней наследственной информацией. Антибиотики с таким механизмом действия обычно высокотоксичны и используются только в химотерапии злокачественных опухолей. В качестве примера можно привести актиномицин D:

8) Токсины : Ряд живых организмов в качестве защиты от потенциальных врагов вырабатывают сильно ядовитые вещества - токсины. Многие из них являются белками, однако, встречаются среди них и сложные низкомолекулярные органические молекулы. В качестве примера такого вещества можно привести ядовитое начало бледной поганки - a-аманитин: Это соединение специфично блокирует синтез эукариотических и-РНК. Для человека смертельной дозой является несколько мг этого токсина. Глава 10. Заключение. В последние десятилетия изменился сам подход к решению основополагающих проблем биологии. Один из основателей молекулярной биологии, английский ученый, лауреат Нобелевской премии Джон Кендрью сказал: “Биологи прежних лет в целом продвигались сверху вниз. Они начинали с целого организма, потом разнимали его на части и рассматривали отдельные органы и ткани; далее они изучали отдельные клетки под микроскопом - так мало-помалу они продвигались вниз от сложного к простому. Новая биология начинает с другого конца и продвигается с самого низа вверх. Она начала с простейших компонентов живого организма - стала изучать отдельные молекулы и их взаимодействие внутри клеток, пренебрегая всем остальным. Теперь пришла пора обратиться к этому остальному и двигаться вдоль иерархии биологической организации”. Однако биология, сложнейшая необъятная наука, отнюдь не сводится к молекулярной биологии или биоорганической химии. Они представляют собой лишь подходы к решению некоторых биологических задач. За последние четверть века на этом пути были сделаны блестящие, иногда даже сенсационные открытия. Есть все основания полагать, что череда этих открытий еще не закончилась, как не закончилась еще революция в биологии. Список литературы: 1. В.Т.Иванов, А.Н.Шамин. Путь к синтезу белка. - Ленинград: Химия, Ленинградское отделение, 1982 г. 2. Д.Г.Кнорре, С.Д.Мызина. Биологическая химия. - М.: Высшая школа, 1998 г. 3. Р. Марри, Д. Греннер. Биохимия человека. Т. 1­-2 . - М.: Мир, 1993 г. 4. А.Уайт, Ф.Хендлер. Основы биохимии. Т. 1-3. - М.: Мир, 1981 г. 5. Б.Албертс, Д.Брей. Молекулярная биология клетки. Т. 1-3. М.: Мир, 1994 г. 6. Г.Шульц, Р.Ширмер. Принципы структурной организации белков. - М.: Мир, 1982 г. 7. А.О.Рувинский, В.К. Шумной. Общая биология. - М.: Просвещение, 1995 г. 8. Н.Н.Приходченко, Т.П.Шкурат. Основы генетики человека. - Ростов‑на-Дону: Феникс, 1997 г. 9. В.Н.Ярыгин. Биология. Т. 1-2. - М.: Высшая школа, 1999 г. ПРИЛОЖЕНИЕ Приложение I

Аминокислота

Формула

Сокращение

3-х букв

1 букв.

Алифатические аминокислоты

Моноаминомонокарбоновые кислоты

1. Глицин (гликокол) аминоуксусная к-та

H – CH – COOH

|

NH2

Gly

G

2. Аланин, a-амино-пропионовая к-та

CH3 – CH – COOH

|

NH2

Ala

A

3. Валин, a-амино-изовалериановая к-та

CH3 – CH – CH – COOH

| |

CH3 NH2

Val

V

4. Лейцин, a-амино-изокапроновая к-та

CH3 – CH - СH2 – CH – COOH

| |

CH3 NH2

Leu

L

5.Изолейцин,

a-амино-

изокапроновая к-та

CH3 – CH2 - СH – CH – COOH

| |

CH3 NH2

Ile

I

6. Серин, a-амино-b-гидроксипропионовая к-та

CH2 – CH – COOH

| |

OH NH2

Ser

S

7. Треонин, a-амино--b-гидроксимасляная к-та

CH3 – CH – CH – COOH

| |

OH NH2

Thr

T

Диаминомонокарбновые кислоты

8. Лизин, a,e,-диаминокапроновая к-та

NH2 - CH2 - CH2 – CH2 - СH 2 – CH – COOH

|

NH2

Lys

K

9. Гидрокси-

лизин

(модификация лизина)

NH2 - CH2 – CH – CH2 - СH 2 – CH – COOH

| |

OH NH2

Hyl

10. Аргинин, a-амино-s-гуаниди-

валериановая к-та

NH2 - C – NH – CH2 – CH2 - СH 2 – CH – COOH

| | |

N NH2

Arg

R

Моноаминодикарбоновые кислоты и их амиды

11. Аспарагиновая к-та, a-аминоянтарная к-та

HOOC – CH2 – CH – COOH

|

NH2

Asp

D

12.Аспарагин,

NH2 - CO – CH2 – CH – COOH

|

NH2

Asn

N

13. Глутаминовая к-та, a-амино-

глутаровая к-та

HOOC – CH2 – CH2 – CH – COOH

|

NH2

Glu

E

13.Глутамин,

NH2 – CO – CH2 – CH2 – CH – COOH

|

NH2

Gln,

Glu

|

NH2

Q

Серусодержащие аминокислоты

14. Цистеин, a-амино-b-тиопропионовая к-та

HS – CH2 – CH – COOH

|

NH2

Cys

C

15. Цистин (модификация цистеина)

NH2

|

S – CH2 – CH – COOH

|

S – CH2 – CH – COOH

|

NH2

Cys

|

Cys

C

|

C

16.Метионин, a-амино-g-тиометил-масляная к-та

СH3 – S СH2 – CH2 – CH – COOH

|

NH2

Met

M

17.Фенилаланин, a-амино-b-фенил-

пропионовая к-та

СH2CH – COOH

|

NH2

Phe

F

18.Тирозин, пара-гидроксифенил-

аланин

HO – – CH­2CH – COOH

|

NH2

Tyr

Y

NH

19. Триптофан, a-амино-b-индолил-пропионовая к-та

CH2CH – COOH

|

NH2

Try, Trp

W

20. Гистидин, a-амино-b-имида-золилпропионовая

к-та

N

CH2CH – COOH

|

NH NH2

His

H

Иминокислоты

21. Пролин

- СOOH

NH

Pro

P

Приложение II Открытие аминокислот в составе белков

Аминокислота

Год

Источник

Кто впервые выделил

1. Глицин

1820

Желатина

А.Браконно

2. Лейцин

1820

Мышечные волокна

А.Браконно

1839

Фибрин, шерсть

Г.Мульдер

3. Тирозин

1848

Казеин

Ф.Бопп

4. Серин

1865

Шелк

Э.Крамер

5. Глутамино-

вая к-та

1866

Растительные белки

Г.Риттхаузен

6. Аспарагино-

вая к-та

1868

Конглутин, легумин

Г.Риттхаузен

7. Фенилаланин

1881

Ростки люпина

Э.Шульце, Й.Барбьери

8. Аланин

1888

Фиброин шелка

Т.Вейль

9. Лизин

1889

Казеин

Э.Дрексель

10. Аргинин

1895

Вещество рога

С.Хедин

11. Гистидин

1896

Стурин, гистоны

А.Коссель; С.Хедин

12. Цистин

1899

Вещество рога

К.Мёрнер

13. Валин

1901

Казеин

Э.Фишер

14. Пролин

1901

Казеин

Э.Фишер

15. Оксипролин

1902

Желатина

Э.Фишер

16. Триптофан

1902

Казеин

Ф.Гопкинс, Д.Кол

17. Изолейцин

1904

Фибрин

Ф.Эрлих

18. Метионин

1922

Казеин

Д. Мёллер

19. Треонин

1925

Белки овса

С.Шрайвер

20.Оксилизин

1925

Белки рыб

С.Шрайвер

Приложение III Цветные реакции на белки Цветные реакции применяются для установления белковой природы веществ, идентификации белков и определение их аминокислотного состава в различных биологических жидкостях. В клинической лабораторной практике эти методы используются для определения количества белка в плазме крови, аминокислот в моче и крови, для выявления наследственных и приобретенных патологий обмена у новорожденных. Биуретовая реакция на пептидную связь. В основе ее лежит способность пептидных связей (– CO–NH– ) образовывать с сульфатом меди в щелочной среде окрашенные комплексные соединения, интенсивность окраски которых зависит от длины полипептидной цепи. Раствор белка дает сине-фиолетовое окрашивание. Реактивы: 1) яичный белок, 1% р-р (белок куриного яйца фильтруют через марлю и разводят дист-ой водой 1:10); 2) NaOH, 10% р-р; 3) Cu(OH)2, 1% р-р. Ход определения. В пробирку вносят 5 капель р-ра яичного белка, 3 капли NaOH, 1 каплю Cu(OH)2, перемешивают. Содержимое пробирки приобретает сине-фиолетовое окрашивание. Нингидриновая реакция. Сущность реакции состоит в образовании соединения, окрашенного в сине- фиолетовый цвет, состоящего из нингидрина и продуктов гидролиза аминокислот. Эта реакция характерна для аминогрупп в a-положении, присутствующих в природных аминокислотах и белках. Реактивы: 1) яичный белок, 1% р-р; 2) нингидрин, 0,5% водный р-р. Ход определения. В пробирку вносят 5 капель р-ра яичного белка, затем 5 капель нингидрина, нагревают смесь до кипения. Появляется розово-фиолетовое окрашивание, переходящее с течением времени в сине-фиолетовое. Ксантопротеиновая реакция. При добавлении к р-ру белка конц-ой азотной к-ты и нагревании появляется желтое окрашивание, переходящее в присутствии щелочи в оранжевое. Сущность реакции состоит в нитровании бензольного кольца циклических аминокислот азотной к-ой с образованием нитросоединений, выпадающих в осадок. Реакция выявляет наличие в белке циклических аминокислот. Реактивы: 1) яичный белок, 1% р-р; 2) конц. азотная к-та; 3)NaOH,10% р-р. Ход определения. К 5 каплям р-ра яичного белка добавляют 3 капли азотной к-ты и (осторожно!) нагревают. Появляется осадок желтого цвета. После охлаждения добавляют (желательно на осадок) 10 капель NaOH, появляется оранжевое окрашивание. Реакция Адамкевича. Аминокислота триптофан в кислой среде, взаимодействуя с альдегидами кислот, образует продукты конденсации красно-фиолетового цвета. Реактивы: 1) неразбавленные яичный белок, 2) конц. (ледяная) уксусная к-та; 3) конц. серная к-та. Ход определения. К одной капле белка прибавляют 10 капель уксусной к-ты. Наклонив пробирку, осторожно по стенке добавляют по каплям 0,5 мл серной к-ты так, чтобы жидкости не смешивались. При стоянии пробирки на границе жидкостей появляется красно-фиолетовое кольцо. Реакция Фоля. Аминокислоты, содержащие сульфгидрильные группы – SH, подвергаются щелочному гидролизу с образованием сульфида натрия Na2S. Последний, взаимодействуя с плюмбитом натрия ( образуется в ходе реакции между ацетатом свинца и NaOH), образует осадок сульфида свинца PbS черного или бурого цвета. Na2S + Na2PbO2 + 2H2O ® PbS¯ + 4NaOH. Реактивы: 1) яичный белок, 1% р-р; 2) реактив Фоля ( к 5% -р-ру ацетата свинца прибавляют равный объем 30% р-ра NaOH до растворения образовавшегося осадка). Ход определения. К 5 каплям р-ра белка прибавляют 5 капель реактива Фоля и кипятят 2-3 мин. После отстаивания 1-2 мин появляется черный или бурый осадок. Приложение IV Реакции осаждения белков. Белки в р-ре и соответственно в организме сохраняются в нативном состоянии за счет факторов устойчивости, к которым относятся заряд белковой молекулы и гидратная оболочка вокруг нее. Удаление этих факторов приводит к склеиванию молекул белков и выпадению их в осадок. Осаждение белков может быть обратимым и необратимым в зависимости от реактивов и условий реакции. В клинической лабораторной практике реакции осаждения используют для выделения альбуминовой и глобулиновой фракций белков плазмы крови, количественной характеристики их устойчивости в плазме, обнаружения белков в биологических жидкостях и освобождения от них с целью получения безбелкового р-ра. Обратимое осаждение. Под действием факторов осаждения белки выпадают в осадок, но после прекращения действия (удаления) этих факторов белки вновь переходят в растворимое состояние и приобретают свои нативные свойства. Одним из видов обратимого осаждения белков является высаливание. Высаливание. Насыщенным р-ом сульфата аммония осаждается альбуминовая фракция белков, полунасыщенным р-ром – глобулиновая фракция. Сущность реакции заключается в дегидратации молекул белка. Реактивы: 1)неразведенный яичный белок; 2) насыщенный р-р сульфата аммония; 3) NaOH, 10% р-р, 4) CuSO4, 1% р-р; 5) дистл-ая вода; 6)сульфат аммония в порошке. Ход определения. В пробирку наливают 30 капель неразв-го яичного белка и добавляют равное количество насыщенного р-ра сульфата аммония. Содержимое пробирки перемешивают. Получают полунасыщенный р-р сульфата аммония, при этом глобулиновая фракция осаждается, а альбуминовая остается в р-ре. Последнюю отфильтровывают, затем смешивают с порошком сульфата аммония до тех пор пока не прекратится раств-ие соли, при этом выпадает осадок – глобулины. Необратимое осаждение белков. Необратимое осаждение белков связано с глубокими нарушениями структуры белков (вторичной и третичной) и потерей ими нативных свойств. Такие изменения белков можно вызвать кипячением, действием конц. р-ров минеральных и органических к-т, солями тяжелых металлов. Осаждение при кипячении. Белки являются термолабильными соединениями и при нагревании свыше 50-60°С денатурируются. Сущность тепловой денатурации заключается в разрушении гидратной оболочки, разрыве стабилизирующих белковую глобулу связей и развертывании белковой молекулы. Наиболее полное и быстрое осаждение происходит в изоэлектрической точке (когда заряд молекулы равен нулю), поскольку частицы белка при этом наименее устойчивы. Белки, обладающие кислыми свойствами, осаждаются в слабокислой среде, а белки с основными свойствми – в слабощелочной. В сильнокислых или сильнощелочных р-рах денатурированный при нагревании белок в осадок не выпадает, т.к. его частицы перезаряжаются и несут в первом случае положительный, а во втором – отрицательный заряд, что повышает их устойчивость в р-ре. Реактивы: 1) яичный белок, 1% р-р; 2) уксусная к-та, 1% и 10% р-ры; 3) NaOH, 10% р-р. Ход определения. В 4 пронумерованные пробирки приливают по 10 капель р-ра яичного белка. Затем 1-ю пробирку нагревают до кипячения, при этом р-р мутнеет, но т.к. частицы денатурированного белка несут заряд, они в осадок не выпадают. Это связано с тем, что яичный белок имеет кислые свойства ( его изоэлектрическая точка 4,8) и в нейтральной среде заряжен отрицательно; во вторую пробирку добавляют 1 каплю 1% р-ра уксусной к-ты и нагревают до кипячения. Белок выпадает в осадок, т.к. его р-р приближается к изоэлектрической точке и белок теряет заряд ( один из факторов устойчивости белка в р-ре); в 3-ю пробирку добавляют 1 каплю 10% р-ра уксусной к-ты и нагревают до кипения. Осадка не образуется, т.к. в сильнокислой среде частицы белка приобретают положительный заряд ( сохраняется один из факторов устойчивости белка в р-ре); в 4-ю пробирку наливают 1 каплю р-ра NaOH, нагревают до кипения. Осадок не образуется, поскольку в щелочной среде отрицательный заряд белка увеличивается. Осаждение концентрированными минеральными к-тами. Концентрированные кислоты (серная, хлористоводородная, азотная и др.) вызывают денатурацию белка за счет удаления факторов устойчивости белка в р- ре (заряда и гидратной оболочки). Однако при избытке хлористоводородной и серной к-т выпавший осадок денатурированного белка снова растворяется. По- видимому, это происходит в результате перезарядки молекул белка и частичного их гидролиза. При добавлении избытка азотной к-ты растворения осадка не происходит. Вот почему для определения малых количеств белка в моче при клинических исследованиях применяется азотная к-та. Реактивы: 1) яичный белок,1% р-р; 2) конц. серная к-та; 3) конц. хлористоводородная к-та; 4) конц. азотная к-та. Ход определения. В три пробирки наливают по 5 капель концентрированной серной, хлористоводородной и азотной к-т. затем, наклонив пробирку под углом 45°, осторожно по стенке наслаивают такой же объем яичного белка. На границе двух слоев появляется осадок белка в виде белого кольца. Осторожно встряхивают пробирки, наблюдают растворение белка в пробирках с серной и хлористоводородной к-тами, в пробирке с азотной к-ой растворения белка не происходит. Осаждение органическими к-ами. Трихлоруксусноая к-та осаждает только белки, а сульфосалициловая осаждает не только белки, но и высокомолекулярные пептиды. Сульфосалициловой к-ой пользуются при определении белка в моче. Реактивы: 1) яичный белок, 1% р-р; 2) трихлоруксусная к-та, 10% р-р; 3) сульфосалициловая к-та, 10% р-р. Ход определения. В две пробирки вносят по 5 капель р-ра белка. В одну из них прибавляют 2 капли сульфосалициловой к-ты, а в другую – 5 капель трихлоруксусной к-ты. В пробирках выпадает осадок белка. Осаждение белка солями тяжелых металлов. Белки при взаимодействии с солями свинца, меди, ртути, серебра и других тяжелых металлов денатурируются и выпадают в осадок. Однако при избытке некоторых солей наблюдается растворение первоначально образовавшегося осадка. Это связано с накоплением ионов металла на поверхности денатурированного белка и появлением положительного заряда на белковой молекуле. Реактивы: 1) яичный белок, 1% р-р; 2) сульфат меди, 10% р-р; 3) ацетат свинца, 5% р-р; 4) нитрат серебра, 5% р-р. Ход определения. В три пробирки вносят по 5 капель белка. В первую добавляют 1 каплю ацетата свинца, в третью – 1 каплю нитрата серебра. Во всех пробирках выпадает осадок. Затем в первую пробирку добавляют 10 капель нитрата серебра – растворения осадка нет.